(data stored in ACNUC7421 zone)

EMBL: CP000094.PE105

CP000094.PE105       Location/Qualifiers
FT   CDS_pept        107893..108336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0105"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71849"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK57"
FT                   /protein_id="ABA71849.1"
FT                   /translation="MKMPKRLIASLGVLMISAAPLLASADPRDDHDHGGPQQGHYDNRG
FT                   GDHHDWQSNHRGGPPPRDFGPVRQVIRDNHGYFVRGAPPPPGIHLVRGRPLPHGYYGER
FT                   LDNRALSRLPYYPGYEWRRAGGDIVLIAVGTGIVYEVLDGVLY"
     atgaaaatgc cgaaacgtct gattgccagt ctgggcgtgc tgatgatcag cgcagcgccg        60
     ctgctggcca gcgccgatcc gcgcgacgat cacgaccacg gcggcccgca gcagggccac       120
     tacgacaatc gcggtggtga tcaccatgat tggcaaagca accatcgcgg cggcccgccg       180
     cctcgggact tcggcccggt gcgtcaggtg atccgtgaca atcatggcta cttcgttcgt       240
     ggtgcgccgc cccctccagg catccacctg gtacgtggcc gaccgctgcc ccatggctat       300
     tacggcgagc ggctggataa tcgggcgttg agtcgcctgc cgtattaccc gggttatgaa       360
     tggcgtcgcg ccggcggtga catcgtgctg atcgcggtgg gcactgggat cgtttacgaa       420
     gtgctggatg gcgttctgta ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page