(data stored in ACNUC7421 zone)

EMBL: CP000094.PE106

CP000094.PE106       Location/Qualifiers
FT   CDS_pept        complement(108407..110368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0106"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71850"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK56"
FT                   /protein_id="ABA71850.1"
FT                   /translation="MRSLGAWLLAGALLLLGNSAHAGLQLRLKTDGLSPAQQQASQALL
FT                   DEAMQALPPSFIERLDRRIDVGWTDDMPGNAYGQATLVSELDLNRKLLASLTDGSAATQ
FT                   KTNRPHGTVRRELLATVLHEITHIYDRARLWPAAERTLIQRCTRRNNSAGLIGIPDECR
FT                   GQNGRRFTLSDDPRLLDLAGWQQYVGRRGEREQHNRQIARSPDLYEISSPKEFVAVNME
FT                   YFLLDPSYACRRPALYRYYQQHFSWAPPAKDACAKTFAFLNAGNDFAKQPLGQVDPERV
FT                   YAVDYLLAEANQNWVSRWGHSMLRLVICAPGRPRGPDCRLDLDQHLVLSYRAFVGDVQL
FT                   SSWDGLVGKYPSRLFVLPLAQVIDEYTKTELRSLASVPLNLSRSEIEGVVEHAAEMHWS
FT                   YDGNYFFLSNNCAVEGLKLLRSGSNNARLTGLDSIMPNGLLEVLKGRGLADTSVLDDPK
FT                   EALRLGYRFDSFRDRYQAMFDVLKKQLPIKQTTVEEWLSLSAEERRPWFERADLRTSAA
FT                   LLLLEQASFRRQLLLAQDEVKQRYLGARELENGGMDKANATLQQILANSGFLSRPAELL
FT                   DSRGYGLPQPSEFSRLEAESSQRQKQLLALTGDLDKEVRALLEPKRAAEIAASEANVKQ
FT                   IGEHLRKLHKASGGLELP"
     gtgaggtcac tcggcgcctg gctgctggcc ggggcgttgt tgctgcttgg caacagcgcc        60
     cacgccggcc tgcaattgcg gctcaagacc gatggcttga gccccgccca acaacaggcc       120
     agccaggcgc tgctcgatga agccatgcag gcattgccgc cgagcttcat cgaacgcctg       180
     gaccggcgca tcgatgtcgg ctggaccgac gacatgcccg gcaacgccta tggtcaggcg       240
     acgctcgtct ccgagctgga cctgaaccgc aaactgctcg ccagcctcac cgatggcagc       300
     gcggccactc aaaaaaccaa tcgcccccac ggcactgtac gccgggaact gctggccacg       360
     gtgctgcacg aaatcaccca catttacgat cgcgcgcgct tgtggccggc ggccgaacgc       420
     acgctgatcc agcgctgtac ccgccgcaac aacagcgccg ggctgatcgg cattcccgat       480
     gagtgccgcg gccagaacgg tcgccgcttc accctcagcg atgatccacg cctgctcgac       540
     ctcgccggct ggcagcaata cgtcggccgt cgtggcgaac gtgaacagca caaccggcag       600
     atcgcccgca gccccgacct ctacgaaatc tccagcccga aggagtttgt cgcggtcaac       660
     atggagtatt tcctcctcga cccgagctac gcctgccgcc gcccggcgct gtatcgctat       720
     taccagcagc acttcagctg ggcaccgccg gccaaggatg cgtgcgccaa aaccttcgcc       780
     ttccttaacg ccggcaacga ctttgccaaa cagcccctgg gccaggtcga tccggagcgc       840
     gtgtacgcgg tggattacct gttggccgaa gccaaccaga actgggtcag ccgttggggc       900
     cacagcatgc tgcgtctggt gatctgcgca ccgggccgac cgcgcgggcc ggactgccga       960
     ctggatctgg accagcatct ggtgctgtca taccgcgcct tcgtcggcga cgtgcagttg      1020
     tcgagctggg acgggctggt cggcaagtac ccgtcgcgcc tattcgtgtt gccgctggcg      1080
     caggtgatcg acgaatacac caagaccgaa ctgcgcagcc tcgcttcggt cccgctgaat      1140
     ctctcgcgca gcgaaatcga gggcgtggtc gaacacgccg ccgaaatgca ctggagctac      1200
     gacggcaatt acttcttcct ctccaataac tgtgcggtcg aaggcctgaa gctgctgcgc      1260
     agcggcagca acaacgcccg gctcaccggc ctcgacagca tcatgcccaa cggtttgctg      1320
     gaagtgctga agggccgagg cctggccgac accagcgtgc ttgatgatcc gaaagaggcg      1380
     ttgcgcctgg gttatcgctt cgactcgttc cgtgatcgtt atcaggcgat gttcgatgtg      1440
     ttgaagaagc aattgccgat caagcagaca accgttgaag aatggctttc gctgtccgcc      1500
     gaagagcgtc gcccatggtt cgaacgggct gacctgcgca ccagcgccgc gctgctattg      1560
     ctggagcaag ccagctttcg ccgccaactg ttgctggctc aggatgaggt caagcaacgc      1620
     tacctcggcg cccgggagct ggagaacggt ggcatggaca aggccaacgc gaccttgcag      1680
     cagatcctcg ccaacagcgg cttcctcagc cgaccggcag aactgctcga ctcccgaggt      1740
     tatggcctgc cgcaaccaag cgaattcagc cgactggaag cagaaagcag ccagcgccag      1800
     aaacaattgc tggccctgac cggcgatctc gataaggaag tacgcgcatt gctcgagccc      1860
     aaacgagcag ccgaaattgc ggccagcgag gccaacgtaa aacagatcgg cgaacatctg      1920
     cgcaaactgc acaaagcctc gggcggactg gaactgccct ga                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page