(data stored in ACNUC7421 zone)

EMBL: CP000094.PE108

CP000094.PE108       Location/Qualifiers
FT   CDS_pept        complement(110713..111021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0108"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71852"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK54"
FT                   /protein_id="ABA71852.1"
FT                   /translation="MRFLTNLLIPSVLITACWVPLADAFDVSTQNTVVSVWATGMVSSA
FT                   PFDRKLIVAAHDDAAAFVASDGQMRGAQLESALHYLRKSRPKLHVSDLELAQAILVQ"
     atgcgttttc ttacaaatct gcttatcccc tctgtactga tcaccgcctg ctgggttcct        60
     ctggcagacg ccttcgatgt gtccacgcag aacaccgttg tcagcgtctg ggccaccggc       120
     atggtgtctt ccgcgccgtt cgaccgtaaa ctgatcgtcg ccgcgcacga cgatgccgca       180
     gcgttcgttg ccagtgacgg ccagatgcgc ggcgcacagc tcgaatccgc cctgcattac       240
     ctgcgcaaga gccggccaaa acttcatgtc agcgaccttg aactggcaca ggcaattctc       300
     gtccaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page