(data stored in ACNUC7421 zone)

EMBL: CP000094.PE113

CP000094.PE113       Location/Qualifiers
FT   CDS_pept        complement(115458..115778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0113"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71857"
FT                   /db_xref="GOA:Q3KK49"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK49"
FT                   /protein_id="ABA71857.1"
FT                   /translation="MEELISPGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAIS
FT                   AIVIVGAMLAAALTVTPLGKTMGTLAVALAAVNVFGGFLVTRRMLEMFKKKAPKAKEEA
FT                   PK"
     atggaagagc ttatctcccc cggtatctac aacctgatca tcttcgtgct ggcgatttat        60
     gtcggttacc acgtggtctg gaacgttaca cccgcgctgc acacgccgct gatggcagta       120
     accaacgcca tttcggcgat cgtgatcgtc ggcgccatgc tcgcggctgc actgaccgtc       180
     accccgctgg gcaagaccat gggcaccctc gccgtggcac tggccgcggt caatgtgttc       240
     ggtggcttcc tggtcacccg ccgcatgctt gagatgttca agaagaaagc cccgaaagca       300
     aaagaagagg cgcctaagta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page