(data stored in ACNUC7421 zone)

EMBL: CP000094.PE114

CP000094.PE114       Location/Qualifiers
FT   CDS_pept        complement(115794..116915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0114"
FT                   /product="NAD(P) transhydrogenase subunit alpha 1"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71858"
FT                   /db_xref="GOA:Q3KK48"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK48"
FT                   /protein_id="ABA71858.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLISQGHKVTVQTGAGVKASV
FT                   VDSAYEAAGATIGSANDAFGAELILKVVAPSDAELTLIKRGTVLVGMLNPFNNDTIAKM
FT                   AECGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAGTVK
FT                   AARVLILGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFVDVPYETDEERE
FT                   CAVGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSADTVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVIENGVTIVGPTNLAGEVAADASALYARNLLDFLKL
FT                   VFTKEGQFEVNLEDDIVAACLMCRDGQVIRKNA"
     gtgcacattg gtgttcctct cgaaacccag accggtgaaa cacgggttgc tgcaaccccg        60
     gaaaccatta aaaagctgat cagccaaggt cataaggtca ctgtgcaaac cggcgccggc       120
     gttaaagcca gcgttgtcga cagtgcctat gaagcggcag gcgcaaccat tggcagtgcc       180
     aatgacgcgt ttggcgccga gctgattctc aaagtggtcg cgccaagcga tgccgaactg       240
     acgctgatca agcgcggaac ggtgctggtg ggcatgctca acccattcaa caacgacacc       300
     atcgcaaaga tggccgagtg cgggattacc gcgtttgccc tggaagcggc gccacgtacc       360
     tcccgggccc agagcctcga cgtgctgtca tcccaggcga acattgccgg ctataaggcc       420
     gtgctgctgg ccgctcatta ctatccgcgc ttcatgccga tgctgatgac tgctgcgggc       480
     accgtgaaag cggcgcgcgt gctgattctg ggggctggtg tggccgggtt gcaggcgatt       540
     gccacggcga aacgtctggg tgccgtcatc gaagcgtccg acgtacgtcc ggccgtgaag       600
     gaacagatcg aatccctcgg cgccaagttc gtcgacgtgc cttacgaaac cgatgaagaa       660
     cgcgaatgcg cggtcggcgt cggcggttac gcacgcccga tgccggcgag ctggatgcag       720
     cgtcaggccc aagccgtgca cgagcgcgcc aagcaggctg acatcgtcat caccaccgca       780
     ctgataccgg gccgcaaggc accgacgctg ttgagcgcgg acaccgtggc gcagatgaaa       840
     cccggctcgg tggtcatcga cctcgctgca gcccagggtg gcaactgccc gctgaccgtg       900
     gccgatcagg tcgtgatcga gaacggcgtg accatcgtcg gcccgaccaa cctcgccggt       960
     gaagtcgccg cagacgcctc ggcgctgtat gcacgcaacc tgctggactt cctgaagctg      1020
     gtcttcacca aagaaggcca gttcgaagta aacctcgaag acgatatcgt cgccgcgtgc      1080
     ctgatgtgcc gcgacggcca agtcatccgc aaaaacgcct aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page