(data stored in ACNUC7421 zone)

EMBL: CP000094.PE119

CP000094.PE119       Location/Qualifiers
FT   CDS_pept        complement(121036..121407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK43"
FT                   /protein_id="ABA71863.1"
FT                   /translation="MISRGVTCDADNLVDYQSDSTSTHTNCLIQLLKSGWLRSFVSTEA
FT                   RILQQPHLLSSDYFQKFSKISSTTSTTCASDLSLAGGEFYSVTRCCQHLFFSVFDREDR
FT                   TVESAKQTGISNSFQSSMN"
     ttgatttctc gcggagtaac ttgtgatgct gataatcttg ttgactatca gtctgactcc        60
     acaagcaccc acacgaattg cttgattcag ttgttaaaga gcggttggtt aagatctttc       120
     gtctcaaccg aggcgcgcat tctacagcag cctcatttgc tgtcaagtga ttattttcag       180
     aagttttcga agatttcttc aacaacttca accacttgcg cttccgatct ctcgttagcg       240
     ggaggcgaat tctacagcgt tacacgctgc tgtcaacacc tctttttctc cgttttcgac       300
     cgagaagatc gaaccgttga aagcgccaaa cagaccggca tttccaactc cttccagtct       360
     tcgatgaact ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page