(data stored in ACNUC7421 zone)

EMBL: CP000094.PE124

CP000094.PE124       Location/Qualifiers
FT   CDS_pept        132635..134515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0124"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71868"
FT                   /db_xref="GOA:Q3KK38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK38"
FT                   /protein_id="ABA71868.1"
FT                   /translation="MNLKFSHKILLAASGVVVLAFALFTLYNDYLQRNTIRQNLQSSVQ
FT                   QAGDLTASSVQNWMSGRILVLENLAQNVAHQGKNADFPGLVDQPAFTSNFQFTYVGQAN
FT                   GVFTQRPDAKMPDGYDPRQRPWYKQAVAADQTMLTPPYMAAVGGLVVTIAMPVKKNGEL
FT                   LGVVGGDLSLETLVKIINSVDFGGLGHAFLVSGDGQVIVSPDKDQVMKNLKDIYPNAGV
FT                   RIEKGNQNVVLNGQERILSFTPVAGLPNAEWYIGLSIDRDKAYAALSQFRTSAVIAMFV
FT                   AVGAIAVFLSLLITVLMRPLITMGRAMQDIAQGEGDLTRRLVVESKDEFGELGSSFNQF
FT                   VERIHASISEVSSATRHVHDLSQRVMASSNASIIGSDEQSARTNSVAAAINQLGAATQE
FT                   IARNAADASQHASGASEQADDGRQVVEQTIQAMTELSQKISLSCTQIETLNASTDNIGH
FT                   ILDVIKGISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLAHRTQESAEEIHKMIT
FT                   SLQVGSREAVTTMNASQASSEETVEVANQAGLRLVSVTQRIGEIDGMNQSVAAATEEQT
FT                   AVVETLNVDVNQINLLNQQSVANLNETLKDCDALSQQANRLKQLVDSFKI"
     atgaatctca agttcagcca taaaatcctg ctggccgcct cgggcgttgt ggtcctggcg        60
     ttcgcgctgt tcactttgta caacgactat ctgcagcgaa atacgattcg ccagaacctc       120
     cagtcctcgg tccagcaggc cggtgacctg accgccagca gtgtgcagaa ctggatgagc       180
     ggacggattc tggtgctgga aaacctcgcg cagaacgtcg ctcatcaagg caagaacgcc       240
     gacttcccgg gcctggtcga tcaaccggcc ttcacctcga acttccagtt cacctacgtc       300
     ggccaggcca acggtgtgtt cacccagcgc cctgacgcga agatgccgga cggctacgac       360
     ccgcgtcagc gcccgtggta caagcaggcc gtggccgctg accagaccat gctgaccccg       420
     ccatacatgg ctgccgttgg cgggctggtg gtgaccatcg ccatgccggt gaaaaagaac       480
     ggcgaactgc tcggcgtagt gggcggtgac ctgagcctgg aaaccctggt aaagatcatc       540
     aactcggtgg acttcggtgg cctgggccac gcgttcctgg tcagcggtga cggtcaggta       600
     atcgtcagcc cggacaaaga ccaggtgatg aagaacctca aagacatcta cccgaacgcc       660
     ggtgtgcgca tcgagaaggg caatcaaaac gtggtgctca acggccagga acgcatcctg       720
     tcgttcaccc cggttgccgg tctgccgaat gccgagtggt acatcggtct gtcgatcgac       780
     cgcgacaagg cctacgccgc actcagccag ttccgtacct ctgcagtgat tgcgatgttc       840
     gttgcggtgg gcgcgattgc agtgttcctg agcctgctga tcaccgtgct gatgcgtccg       900
     ctgatcacca tgggccgcgc gatgcaggac atcgcccagg gtgaaggtga cctgacccgt       960
     cgtctggtag tggaaagcaa ggacgagttc ggcgagttgg gcagttcgtt caaccagttc      1020
     gtggagcgga ttcacgcttc gatctccgaa gtgtcttccg cgactcgcca cgtacacgat      1080
     ctgtcccaac gggtgatggc atcgtccaac gcttcgatca tcggctccga cgagcaaagc      1140
     gcgcgcacca acagtgtcgc tgcggcgatc aatcagttgg gtgccgccac ccaggaaatc      1200
     gcccgcaacg ccgccgacgc ttcgcaacac gccagtggcg cgagcgagca ggccgatgac      1260
     ggtcgtcagg tggtcgagca gacgattcag gccatgaccg agctgtcgca gaagatcagc      1320
     ctgtcgtgca cccagatcga aaccctgaat gccagcaccg acaacatcgg ccacattctc      1380
     gacgtgatca aaggcatctc ccaacagacc aacctgctgg cgctcaacgc agccatcgaa      1440
     gcggcccgtg ccggtgaagc cggacgcggt tttgcggtgg tggcggacga ggtgcgtaac      1500
     ctcgctcacc gcactcagga atcggcggaa gaaatccaca agatgatcac ttcgctgcag      1560
     gtcggctccc gcgaagcggt gaccaccatg aacgccagtc aggcgtccag cgaggaaacc      1620
     gttgaagtgg cgaaccaggc cggtctgcgt ctggtcagcg tgacccagcg catcggcgaa      1680
     atcgatggca tgaaccagtc ggtggccgcc gctaccgagg aacagactgc cgtggtggaa      1740
     accctcaacg tcgacgtcaa ccagatcaac ctgctgaacc agcagagcgt ggccaacctc      1800
     aatgaaacgt tgaaggattg cgatgcgttg tcgcagcagg ccaaccgttt gaaacagctg      1860
     gtcgacagct tcaagatctg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page