(data stored in ACNUC7421 zone)

EMBL: CP000094.PE127

CP000094.PE127       Location/Qualifiers
FT   CDS_pept        complement(138468..139397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71871"
FT                   /db_xref="GOA:Q3KK35"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK35"
FT                   /protein_id="ABA71871.1"
FT                   /translation="MNAADYQSFADAWESRATIRTRPRRVLEGDARLIYPLSRQPLVLS
FT                   ETFLRECPEQRDFALVQTLYKFINDVVIFETEIVDKTARSIAKNRFAVAFPFACRYDAM
FT                   TVVVDEDYHALVAMDFMQQTVAMTGVEPIELPNEIELSRAIPAAVELAPEHLRSAVELI
FT                   CVAIAENTVTGDVAAFARDDTVKPSIKGLMADHLLDEGRHSNFWARMVRIYWHTASDAD
FT                   RECIAQILPVFIGHYLTNDIQKSFDLRLIDALPVNDATRRALKDEMAGLAFPINRHHPL
FT                   VGNIVRFFHNSSLLDTPCVQHALRDYLV"
     atgaacgccg ccgactacca gtctttcgcc gacgcctggg aaagccgcgc gaccattcgc        60
     accagaccac gccgcgtgct ggagggcgac gcgcggctga tctatccgct cagccgccag       120
     ccgttggtgc tcagcgaaac cttcctgcgc gaatgcccgg aacagcgtga tttcgccttg       180
     gtgcagacgc tgtacaaatt catcaacgac gtggtgattt tcgaaaccga gatcgtcgac       240
     aaaaccgcgc gcagcatcgc caagaaccgc ttcgccgtgg ccttcccgtt cgcctgtcgc       300
     tacgacgcca tgaccgtggt ggtggacgag gattaccacg cgttggtagc gatggatttc       360
     atgcagcaga ccgtggccat gaccggcgtc gagccgatcg agctgccgaa tgaaatcgaa       420
     ctgagccggg cgattccggc tgccgtcgaa ctggccccgg agcacctgcg cagcgccgtg       480
     gaactgatct gcgtcgccat cgccgagaac accgtgaccg gcgatgtcgc agcgttcgcc       540
     cgggacgaca cggtcaagcc gtcgatcaag ggcctgatgg ccgaccactt gctcgacgag       600
     ggccggcact cgaatttctg ggcgcggatg gtgcgtatct actggcatac cgcgagcgat       660
     gcggatcgcg aatgcatcgc gcagatcctg ccggtgttca tcggccatta cctgaccaac       720
     gacatccaga agtccttcga cctgcgcctg atcgatgcct tgccggtcaa cgatgcaacg       780
     cgtcgagcgc tgaaggacga gatggccgga ctggccttcc cgatcaatcg tcatcacccg       840
     ctggtgggca acatcgtgcg ctttttccac aacagctcac tgctcgacac tccgtgcgtg       900
     cagcacgccc tgcgcgacta cctggtttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page