(data stored in ACNUC7421 zone)

EMBL: CP000094.PE128

CP000094.PE128       Location/Qualifiers
FT   CDS_pept        complement(139394..140167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71872"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK34"
FT                   /protein_id="ABA71872.1"
FT                   /translation="MPTKEQLTLKKAELSVHPIFSEIDSLATLRRFMESHVFAVWDFMS
FT                   LTKRLQQELTCTRLPWLPPRDPRAARLINEIVLGEESDDRLSHGHYSHFELYLDAMREV
FT                   GADTTAVERFVTLQQEGVSYDVALQSVEVDPAAARFVRDTLHTALNAPGHSVAAAFLHG
FT                   RESVIPTMFQRMLDAWGIGVEQAPTFRYYLERHIEVDSEDHGPAAEQLLDRLVDGDPQR
FT                   EAEVYASAIAAVESRIALWDGLRLSMREPLAEVAQ"
     atgccaacca aagagcaact tacactaaag aaagccgaac tcagcgttca tccgatcttt        60
     tccgaaatcg attctttggc gacattgcgc cggttcatgg aatcccatgt atttgccgtc       120
     tgggacttca tgtcactgac caagcgcctg cagcaggaac tgacttgcac tcgcctgccg       180
     tggttgccgc cacgggatcc gcgcgcggca cgactgatca atgaaatcgt gctcggcgaa       240
     gaatcggacg atcggctgtc acacgggcat tacagtcact tcgaactgta cctcgatgcg       300
     atgcgcgaag tcggtgcgga cacgacagcg gtggagcgct tcgtgacact gcaacaggaa       360
     ggcgtgagtt acgacgtcgc cctgcaaagc gtcgaggttg atccagcggc ggcgcgattc       420
     gtccgtgaca ccttgcacac cgcactgaat gcacccggtc acagcgttgc cgccgcattc       480
     ctgcatggtc gcgagagcgt gatcccgacc atgttccagc gcatgctcga tgcctggggc       540
     attggcgtcg agcaggcacc gaccttccgt tactacctgg agcgacacat cgaggtcgac       600
     tccgaagacc acggcccggc cgccgagcaa ctgctggatc gactggtgga cggcgatccg       660
     cagcgcgaag ccgaggtcta cgccagcgcc atcgccgccg tggaaagccg catcgccctg       720
     tgggacggtc tgcgcctgag catgcgcgaa ccgctggcgg aggtggccca atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page