(data stored in ACNUC7421 zone)

EMBL: CP000094.PE147

CP000094.PE147       Location/Qualifiers
FT   CDS_pept        177213..179309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0147"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71891"
FT                   /db_xref="GOA:Q3KK15"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK15"
FT                   /protein_id="ABA71891.1"
FT                   /translation="MTLPNLRADLQLSPAAPALDGSPRWTLADPVRGRYFKLGAAAMRL
FT                   LRHWSLGDPEQVLRAANREPGLPLDGVELEQLLTFLRGHDLISALDDQQRASYSLKALA
FT                   QRQSLWTILLHQYLFFRIPLWRPDAFLNRAWPWLERFGPRVLRYVLPATLALGVFLVSR
FT                   DWQRFVGTFPHLFSLGGAIAFGISLFFAKLCHEFGHAFMAKRAGCRVQSMGVAFMVLLP
FT                   MFYTDVSDAWRVNDRRARLLIGAGGVLAELLLASIALLVWSFLPDGPGRTAAFMLASAT
FT                   WITTLVVNLNPFMRFDGYFLLSDLWEVDNLQGRAFAFCRWRLREFLFGYGAPAPEPWSP
FT                   TMQRRLLIWGYGSWLWRAALFFGIALAVYHLFFKVLGIFLMLVELVWFIFLPIMSEWRQ
FT                   WWSRREQAHGPRVLLSSLAVLGLLLVLIVPWRSSVELPTMLEGGRASALHAPTAARVKA
FT                   VRVADGQTVAQGDVLIELESPDLDSRQAIVRREIRIQQLLMRRQAGRSETAADAGIVEQ
FT                   RLAEAVAEYRGLTAQRERLLLRAPHAGTVRDLLPNLTPGRWLSSKDALARVVEDGTRLR
FT                   GYLAEAELWRVKPGATGRFIADDPMHAAIAVQLNEIDTNGVAYVDQEALTSDHHGPIAV
FT                   RRDQQHRAEPVQAQYGVRLTTLDQAATPVQPLRGVVVLQGSGESVLGVAWRRMAALGVR
FT                   ESGF"
     atgaccctgc cgaacctgcg tgccgacctg caattgtcgc ccgcggcgcc ggcattggac        60
     ggttcgccgc gctggaccct ggccgacccg gtgcgcgggc gctacttcaa gcttggcgcg       120
     gcggcgatgc gcctgttgcg tcactggtcg ctgggcgatc ccgaacaagt gctgcgcgct       180
     gccaatcgtg aaccgggttt gccgctggac ggcgtcgagc tggagcaact gctgacgttc       240
     ctgcgcgggc atgacctgat cagcgccctc gacgatcagc aacgcgccag ttactcactc       300
     aaggccctcg cgcaacgcca gagcctgtgg acaatcctgc tgcatcaata cctgtttttc       360
     cgcattccgc tgtggcggcc ggatgccttt ctcaatcggg cgtggccgtg gctggagcgc       420
     tttgggccaa gggttttgcg ctacgttctg ccggcgaccc tggcgctcgg ggtgtttctg       480
     gtgtcgcggg actggcagcg gtttgtcggc acctttccgc atctgttcag cctcggtggc       540
     gcgatcgcgt tcggcatctc gctgtttttt gccaagctct gtcacgaatt cggtcatgca       600
     ttcatggcca agcgcgccgg gtgtcgggtg caaagcatgg gcgtggcgtt catggtcttg       660
     ctgccgatgt tctacaccga tgtcagcgat gcctggcggg tcaatgatcg acgcgcgcga       720
     ctgctgatcg gtgccggcgg ggtgctggcg gagttgctgt tggcgagcat cgcgctgctg       780
     gtctggtcgt tcctgccgga cgggcccggt cgcacggcgg cgttcatgct cgccagcgcg       840
     acctggatca ccacgctggt ggtcaatctc aacccgttca tgcgatttga tggctacttt       900
     ctgctcagcg atttgtggga ggtcgacaac cttcagggcc gggcctttgc cttttgccgc       960
     tggcgcctgc gtgagttctt gttcggctat ggcgcgccgg cgccggagcc ttggtcgccg      1020
     acgatgcagc ggcgtttgct gatctggggg tatggctcgt ggttatggcg tgcggcgttg      1080
     tttttcggga tcgcgctggc ggtctatcac ctgttcttca aggtgttggg gatcttcctg      1140
     atgctggtcg agctggtgtg gttcatcttc ctgccaatca tgagtgagtg gcgccagtgg      1200
     tggagccgcc gcgaacaggc tcatggtccc cgcgtgttgc tcagcagcct ggcggtactc      1260
     ggcctgttgc tggtgctgat cgtgccgtgg cgcagctcgg tcgaattgcc gacgatgctc      1320
     gagggcggtc gcgccagtgc cttgcacgca ccgacggcgg cgcgggtcaa agccgtgagg      1380
     gtggcggatg gtcagaccgt ggctcagggc gacgtgctga tcgaattgga atcgccggac      1440
     ctcgattcgc ggcaggccat cgtccgccgg gaaatccgca ttcagcaatt gctgatgcgc      1500
     cgtcaggccg gccgcagtga aaccgctgcc gacgccggca tcgtcgagca gcgtctcgcc      1560
     gaagcggtgg cggaatatcg cggcctgacc gcccaacgcg aacgtctgct gttacgcgcg      1620
     ccccacgccg gcaccgtgcg tgatctgctg ccgaacctga cgccgggccg ctggctgtcg      1680
     agcaaggatg cgctggcgcg ggtggtcgaa gacggcacgc gactgcgcgg ttatctggcc      1740
     gaggccgaac tgtggcgagt caagcccggc gccaccgggc ggtttatcgc cgacgacccg      1800
     atgcatgccg ccatcgcggt gcaactcaat gaaatcgaca ccaacggtgt ggcctatgtc      1860
     gatcaggaag cgctgacttc cgatcaccac gggccgattg ccgtgcgccg cgatcaacag      1920
     catcgagcgg aaccggtgca ggcgcaatat ggcgtgcgtt tgactacgct ggatcaggca      1980
     gcgaccccgg tgcaaccgct gcgcggcgtg gtggtgttgc agggcagtgg cgagtcggtg      2040
     ctcggcgtgg cctggcgccg gatggcggcg ctgggggtca gggaaagcgg tttctag         2097
//

If you have problems or comments...

PBIL Back to PBIL home page