(data stored in ACNUC7421 zone)

EMBL: CP000094.PE150

CP000094.PE150       Location/Qualifiers
FT   CDS_pept        complement(182010..182834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0150"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71894"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK12"
FT                   /protein_id="ABA71894.1"
FT                   /translation="MTSLEKDLQSPALTALKTRLTRRVATLGCCLVLIASCKTEPPNTF
FT                   KFTADLPPGFAYVAAVYYVPEKGQTCTLDRRDNLAPVFNSKWRTEYKPDAEITIRKIVK
FT                   GCPLVVRRIELEINSSYGKTRGDFSGDEAMVFIRDDLQEQFKGVFNEAGESTFHGQCEW
FT                   WFRTSGKPRILRKILDCRTVDAQGARAYGKTFGAFNPDQLPGKTVRMKITLAADERPAI
FT                   KDTWVKVTNGWKRCMGDNFEDQYAFCYGNYTDFSTFTMPDGQVCTIYPGCTE"
     atgacgtcat tggaaaagga tctgcaatca ccagcgctga ctgccctgaa aaccagactc        60
     acgcggcgtg ttgcaacttt gggctgctgc cttgtcttga tcgcaagctg caagaccgaa       120
     ccgcccaaca ccttcaaatt cacagccgat ctaccaccgg ggtttgccta cgtcgcagcg       180
     gtttattacg tacccgagaa aggtcagacc tgcaccctcg acagacgcga caaccttgcc       240
     ccggtgttca acagcaagtg gcggacggag tacaagccag atgccgagat cacgattcgc       300
     aagattgtta aggggtgtcc gttggtcgtg aggcgaatcg agctggagat caactcgagc       360
     tatggcaaaa cacggggcga cttcagtggt gacgaagcca tggttttcat ccgcgatgat       420
     ctgcaggagc agttcaaagg cgtattcaac gaggccggtg aaagcacctt ccacggtcag       480
     tgcgagtggt ggtttcgcac gtcgggcaaa ccgcgaattc taagaaaaat cctggattgc       540
     agaacggtcg atgcccaagg agcacgtgcc tacgggaaga ccttcggggc ttttaaccct       600
     gatcaactgc cgggcaaaac tgtgaggatg aagatcacct tggcagcgga cgagcgaccg       660
     gccatcaagg acacctgggt caaggtcact aacggctgga aacgctgcat gggcgacaac       720
     tttgaggatc aatacgcctt ctgttacggc aactacaccg acttcagcac tttcaccatg       780
     ccggatggcc aagtctgcac catttatcca ggttgcacgg aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page