(data stored in ACNUC7421 zone)

EMBL: CP000094.PE152

CP000094.PE152       Location/Qualifiers
FT   CDS_pept        complement(183617..184465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71896"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK10"
FT                   /protein_id="ABA71896.1"
FT                   /translation="MTDSVVQRWLFEQHHADRLLCLVLDSQNERDMRQRWLKSSRYEQY
FT                   ASVYGETVVAELADTGPFLFTFDQPDDRRLDALLDRPDSHWGWLASLGQGELNAWVRHW
FT                   QERLLVGTRPHQALYRFHDNRVLARALEHLPSEALPAYLGPAISVCYWQGSHWQSTDNP
FT                   APGTYPLPDSPPWLHLPMPDEQAMEIRLANAHRFLLAEHVQAYAGLACTQDPHIWLRER
FT                   LAQAQAWGWLAPERLEFLLIQSLHTPTLVPHWQPRPDETPDEHFDRVYLLSKSWSGEMP
FT                   S"
     atgaccgact cggttgtaca acgctggctg tttgaacagc accatgccga tcgtctcctg        60
     tgcctggtgc tcgactcgca gaacgaacgc gacatgcgcc agcgctggct gaagagcagc       120
     cgttacgaac agtacgccag tgtctacggt gaaaccgtgg tcgccgaact ggcggacacc       180
     ggcccgttcc tgttcacctt cgaccagccc gacgaccgtc gcctcgacgc cctgctcgac       240
     aggcccgaca gccattgggg ctggctcgcc agcctgggcc agggcgaact gaacgcatgg       300
     gtcaggcact ggcaggagcg gctgctcgtc ggcacccgtc cgcatcaggc gctgtaccgc       360
     tttcacgaca accgggtact ggcccgagcg ctggagcatc tgccgtccga ggcgctaccg       420
     gcgtatctcg ggccggcgat cagtgtgtgt tactggcagg gttcgcactg gcagagcact       480
     gacaatcctg cgcccggcac ttacccgctg ccggactcgc cgccttggct gcacctgccg       540
     atgcccgacg agcaagccat ggaaatccgg ctggccaacg cccaccgctt tctgctggcc       600
     gagcatgtgc aggcctacgc cggattggcg tgcacgcagg atccgcacat ctggctacgt       660
     gagcgactgg ctcaggccca ggcctggggc tggctggcgc cggagcggct ggaatttctg       720
     ctgatccaga gcctgcacac cccgaccctc gtgcctcact ggcaaccccg accggacgaa       780
     acgccggatg aacactttga tcgggtttac ctgctttcga agagctggag cggggagatg       840
     ccttcatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page