(data stored in ACNUC7421 zone)

EMBL: CP000094.PE153

CP000094.PE153       Location/Qualifiers
FT   CDS_pept        complement(184462..186531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0153"
FT                   /product="putative VgrG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71897"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK09"
FT                   /protein_id="ABA71897.1"
FT                   /translation="MFNANARLRLNTDDLDHDLQVLSFTGTESISQPYCFNVKLVSSRP
FT                   DIDLPDLMHRQAFLAFDDNGHGVHGQIQHIGRGDIGHRLTQYHLILAPCLANLGHRFNQ
FT                   RIFQNLSIAQIIGQILQEHGIHADGYLFQIGQALPDREYCVQYNESDLHFIQRLCQEDG
FT                   LHYHFRHSLDRHLLVFGDDQTVFPRLARPTPFKKRNAMVADRPVIHRFECGRNTRTNRT
FT                   RRRAYDFKKAHLVLESEARIPNEPRQPDLEDYLYPDRVLNREHGKLLTRRALERHRSDE
FT                   LTGEGDSDEPALVSGHFLSLSEHPDPALNDLWLLTGIRHEGKQPQVLEESGSDIAVKDQ
FT                   SDFVQGYRNHFEVTPWDAIYRPSLRYDKPSIGCTQTAVVTGPEGEDIHCDAYGRVKVQF
FT                   FWDREGRHNDKSSCWLRTTTNWAGNAHGSVIIPRVGMEVLVTFLNGDPDHPVISGCLAN
FT                   SANPVPYELPAHKTRSVFRSRSTPDSNGFNELMIEDRAGQELIYLRAQRDLQQKIEHDS
FT                   HLEVGNERRESIRGNSVSVLHAEEHRTLTGHRKTHLKASDHLHVSDSSHTRIGQSLTME
FT                   VGRQLCFSAGDHLVLEAGKSISLKVGGEHFVLDHGGLFGSSDLLIGGVPIPFLRARLLQ
FT                   PEDIEDLSAPAPLPPLVAPSQQALMAASKSLGADFCPICEACRAGECAIAEAAA"
     atgttcaatg ccaatgctcg tttgcgcctc aataccgacg acctcgatca cgatctgcag        60
     gtgctgtcct tcaccggcac cgaatccatc agccagccat attgcttcaa cgtcaaactg       120
     gtcagctcga gaccggacat cgatcttccc gacctcatgc accggcaggc ctttctggcc       180
     ttcgatgaca acgggcatgg cgtccatgga cagatccagc acattggccg gggcgatatc       240
     gggcaccggt tgacccaata ccacctgatc ctcgcgccat gcctggcgaa cctgggccat       300
     cgtttcaatc agcggatttt tcagaacctg agcattgcgc aaatcatcgg gcaaattctt       360
     caggaacatg gcatccacgc agatggctat ctgtttcaga tcggccaggc cctgccggat       420
     cgcgaatatt gcgttcaata caacgagtcc gatctgcatt tcatccagcg cctgtgccag       480
     gaagacggcc tgcactatca ctttcgccac agcctcgaca ggcacctgct ggtatttggc       540
     gatgatcaga ccgtatttcc cagactggcc cggccgacac cattcaaaaa gcgcaacgcg       600
     atggtggccg acaggccggt gattcaccgt ttcgagtgtg ggcgaaatac ccgcaccaat       660
     cgcacccgtc ggcgcgccta cgatttcaaa aaggcgcacc tcgtgctgga gtccgaggcg       720
     cgaataccga acgaaccccg ccagcctgat ctggaggact acctgtatcc ggaccgggtc       780
     ctcaaccgtg agcacggcaa actgctgacc cggcgggctc tggaacgcca tcgcagcgat       840
     gagctcacgg gcgaaggcga cagcgacgaa ccagcgctgg tgtcggggca ttttctgtcg       900
     ctgtcagaac accccgaccc cgcgttaaat gacctctggc tgctgaccgg aatccgtcat       960
     gaaggcaagc agcctcaagt acttgaagaa agcggtagcg acatcgccgt gaaggatcaa      1020
     agcgacttcg tccagggcta tcggaaccat ttcgaagtca cgccatggga tgcgatctat      1080
     cgcccgtcat tgcgctacga caaaccttcc atcggctgta ctcagactgc cgtggttacc      1140
     ggcccggaag gcgaagatat ccattgcgac gcctatggcc gggtcaaggt gcagtttttc      1200
     tgggaccgcg aaggccggca caacgacaag agcagttgct ggttgcggac caccacgaac      1260
     tgggccggca acgcccatgg cagcgtgatc attccgcgcg tgggcatgga ggtgctggtg      1320
     acgtttctca acggtgatcc cgaccatccg gtgatcagcg gttgcctggc caacagcgcc      1380
     aacccggtgc cctatgaatt gccggcgcac aagacccgca gcgtgttccg gtcccgcagc      1440
     acgcccgaca gcaatggctt caatgagctg atgatcgaag accgcgccgg tcaggagctg      1500
     atctatctgc gcgcccagcg tgatctgcag cagaagatcg agcacgacag tcacctggag      1560
     gtcggcaacg aacgtcggga aagcatccgt ggcaacagcg tcagcgtgct gcacgcagaa      1620
     gaacaccgca ccctcaccgg tcatcgcaag acccatctca aggccagcga tcatctgcac      1680
     gtcagcgaca gcagtcacac ccggatcggg caatcactga cgatggaagt cgggcggcag      1740
     ctctgtttca gtgccgggga tcatttggtg ctggaggccg gaaagagcat cagcctgaaa      1800
     gtcggtggcg agcatttcgt gctcgatcac ggcggtcttt tcgggagcag cgacctgctg      1860
     atcggcggcg tgcccatacc gttcctgcgc gcccgattgt tgcagcccga agacattgaa      1920
     gacttgtcgg cgcccgcgcc cttgccgcca ctggtggcgc cctcacaaca ggcattgatg      1980
     gccgcgagca aaagcctggg cgcggatttc tgcccgatct gcgaagcctg ccgcgcgggc      2040
     gagtgcgcca ttgcggaggc cgctgcatga                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page