(data stored in ACNUC7421 zone)

EMBL: CP000094.PE154

CP000094.PE154       Location/Qualifiers
FT   CDS_pept        complement(186693..187004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK08"
FT                   /protein_id="ABA71898.1"
FT                   /translation="MLQAVQIQHVQPLLGQQRTLYLPDGTALPIRIEYLDEVPAAKTRY
FT                   SERMPFCLEFNSLVPTEFVDGLCALDLPELGRVEDIFVSRVPALGRDPQLGYFCISFN"
     atgctgcaag cggtgcagat ccaacatgtc cagccgttgc tgggacagca acgcacgctt        60
     tacctgcccg atggcacggc cttgccgatt cggatcgaat accttgatga ggttcccgcg       120
     gcgaaaaccc gctacagcga acgcatgccc ttctgcctgg aattcaacag cctggtaccg       180
     accgagtttg tcgacggttt gtgcgcgctg gacctgccgg aactcggtcg ggtagaggac       240
     atcttcgtgt cgcgggtgcc ggcgctggga cgggatccgc agttgggtta tttctgcatt       300
     tccttcaact ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page