(data stored in ACNUC7421 zone)

EMBL: CP000094.PE159

CP000094.PE159       Location/Qualifiers
FT   CDS_pept        complement(191386..191850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71903"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK03"
FT                   /protein_id="ABA71903.1"
FT                   /translation="MRRVVATAVAADTSAAGLAAQRTGARPGRTAMTTALTAKTTATTT
FT                   GTAVERTGDTAATAATGRRVAGDRDVVQGEDAGVENPPAHGAGCAVAAITAIARDQAPG
FT                   NDQTIQGHRAAGGDFHHSGPVLAIERDVGNPVVVQVTIDSNVLVDQQFRG"
     gtgcgtcgcg tcgtagccac cgccgtagcc gccgacacca gcgctgccgg cctggccgcc        60
     cagcgtaccg gtgcccggcc cggccgtacc gccatgacca ccgccctgac cgccaagacc       120
     accgccacca ccaccggcac cgccgtagaa cgcaccggtg acaccgccgc caccgccgcc       180
     accggccgcc gcgttgccgg tgaccgagac gttgttcagg gtgaggatgc cggcgttgaa       240
     aatccccccg cccatggcgc cggttgcgcc gtagccgcca ttaccgccat tgcccgagac       300
     caggccccgg gtaatgacca gaccatccag ggtcaccgtg ctgccggagg tgatttccac       360
     cactcgggtc cggtattggc catcgagcgt gacgtcggca accccgtcgt tgttcaggtc       420
     accatcgaca gtaatgttct tgttgatcag caattccgag gttag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page