(data stored in ACNUC7421 zone)

EMBL: CP000094.PE161

CP000094.PE161       Location/Qualifiers
FT   CDS_pept        198796..200310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71905"
FT                   /db_xref="GOA:Q3KK01"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK01"
FT                   /protein_id="ABA71905.1"
FT                   /translation="MKKSQKLFGASLLALAISGCAVTSEPIERSVSEQRARADLQSMYK
FT                   GQEPLSGPLTLHQAMARAVKYNLEGRLKIMEEALAKRQLDLASFDMLPRMALDAGYVGR
FT                   NNVSASSSQSVRTGTQSLEPSTSQDRDRDVADLTMVWNVLDFGVSYISAKQQGDQRLIV
FT                   QERRRKVINTIVQDVRSAYWRAMAAERLLKQIDSLMARVDTARRNSESMSEQRIGDPVQ
FT                   SLGYQRSLIEATRQLEEQRRALSLAKTELATLINLPLGTNLTLATDDGYRIPELKVDLS
FT                   KLEQEALTSRPELREQDYQTRISAAETRKAMLRLLPGLEFSAGGHYDSNSFLVEQGWAD
FT                   YGVKVTWNLFNVISAPAAIDVAKAGEEVATARRQAMSIAVLAQLYVANANYQEALRQFK
FT                   TNQQLSDIDGQIVGQLRNRRQADGIGELDLIQGELNTLQADLRRDLSYADLRNAYGQIF
FT                   ASAGLDPLPDQVQSTEVQSIATALANREAAWASGDISLPVAHAAAQ"
     atgaagaaaa gtcagaagtt gttcggcgcc agcctgctgg cgctggcgat cagcggatgt        60
     gcagtgacca gtgaaccaat cgagcgcagt gtcagcgaac aaagggcccg ggccgacctg       120
     caaagcatgt acaagggcca ggaaccgctg agcggtccgc tgaccctgca ccaggcgatg       180
     gcccgcgcgg tgaaatacaa cctcgaaggc cgcttgaaaa tcatggagga agcgctggcc       240
     aagcggcagc tcgacctcgc cagtttcgac atgctgccgc gcatggcgct ggacgccggt       300
     tacgtcggac gcaacaacgt cagcgcctcc agcagccaga gtgtgcgtac cggcactcag       360
     tctctggaac cgtcgacctc acaggaccgc gaccgtgacg tcgccgacct gaccatggtc       420
     tggaacgtcc tcgatttcgg tgtcagctac atcagcgcca agcagcaggg cgaccagcgc       480
     ctgatcgttc aggagcgccg gcgcaaggtg atcaacacca tcgttcagga cgtgcgctcg       540
     gcctattggc gggcgatggc cgccgaacgc ctgctcaagc agatcgacag cctgatggcg       600
     cgagtcgaca ccgcccgccg taacagcgaa agcatgagcg aacagcgcat cggtgatccg       660
     gtgcagtcgc tcggttatca gcgttcgctg atcgaagcga cccggcaact ggaagaacaa       720
     cgccgcgcgc tgtcgctggc gaaaaccgaa ctggcgaccc tgatcaacct gccgctgggc       780
     accaacctga ccctggccac cgatgacggt taccggatcc cggaactcaa ggtcgatctg       840
     agcaaactcg aacaggaagc cctgaccagc cgtccggaac tgcgcgagca ggattaccag       900
     acccggatca gcgccgccga aacccgcaag gccatgctgc gtctgctgcc gggtctggag       960
     ttctccgccg gcgggcacta cgacagcaac tcgttcctgg tcgaacaggg ctgggccgac      1020
     tacggcgtca aagtcacctg gaacctgttc aacgtgatct ctgccccggc ggccatcgat      1080
     gtggcgaagg ccggtgaaga agtggcaacc gcgcggcgtc aggcgatgtc gattgcagtg      1140
     ctggcgcagc tctacgtggc caacgccaac tatcaggagg cgctgcgcca gttcaagacc      1200
     aaccagcaac tgtcggacat cgacgggcaa atcgtcggtc agttgcgcaa ccgtcgtcag      1260
     gccgacggca ttggtgagct ggacctcatt cagggcgaac tcaacacctt gcaggccgat      1320
     ctgcgtcgcg atctgtccta cgccgatctg cgcaacgcct atggccagat cttcgccagc      1380
     gctggcctcg atccgctgcc ggatcaggtg cagtcgaccg aggtccagtc gatcgccacc      1440
     gcgctggcca accgcgaagc cgcgtgggcc tcgggggata tttcgctgcc ggtggcccat      1500
     gccgccgcgc agtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page