(data stored in ACNUC7421 zone)

EMBL: CP000094.PE162

CP000094.PE162       Location/Qualifiers
FT   CDS_pept        200315..200899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0162"
FT                   /product="putative adenylylsulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71906"
FT                   /db_xref="GOA:Q3KK00"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KK00"
FT                   /protein_id="ABA71906.1"
FT                   /translation="MAPTASISRAQREARNGHRGTAMLLTGLPAAGKSTLAQALHAELF
FT                   SRGLQSVVLDGDGLRVGLNRDLGFTDADRLENIRRASELAALLVENGQIVILAMIAPLA
FT                   ELREVFARRLGEDYREVWCSAALAVCEQRDPKGHYARARRGELAGFTGVSAPYEAPAQA
FT                   SLVLDTGTLTVEACLDRLLTWLGESAVLPKA"
     ttggcgccga ccgccagcat cagccgtgcc caacgcgagg cccgcaacgg ccatcgcggc        60
     acggcaatgc tgctgaccgg cttgccggcg gcgggcaaat cgacccttgc ccaggcgttg       120
     catgccgagt tgttcagtcg tggtctgcaa agtgtggtgc tcgatggcga tggcctgcgc       180
     gtcgggctca accgtgacct gggttttacc gatgccgacc gcctggaaaa catccgccgc       240
     gccagtgagc tggcggcgtt gctggtggag aacgggcaga tcgtgattct ggcgatgatc       300
     gcgccgttgg cggaactgcg cgaagtgttt gcccgccgtt tgggcgagga ctatcgcgag       360
     gtctggtgca gcgccgcgct ggcagtgtgc gagcagcgcg atccgaaagg gcattacgcc       420
     cgggcccggc gtggcgagct ggccgggttt accggcgtgt cagcacctta cgaggcaccg       480
     gcccaggctt cgctggtgct cgacaccggc acgctgacgg tcgaagcctg tctcgaccgg       540
     ttgctgacct ggctcggcga atccgcggtg ttgcccaagg catga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page