(data stored in ACNUC7421 zone)

EMBL: CP000094.PE165

CP000094.PE165       Location/Qualifiers
FT   CDS_pept        complement(203369..203896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0167"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71911"
FT                   /db_xref="GOA:Q3KJZ5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ5"
FT                   /protein_id="ABA71911.1"
FT                   /translation="MNIRCCALALLLLSGSVIAADNPFTAASPVGLWLITLGITFLIAE
FT                   AALPNYGVIGLGGIVMFVIGALILSNAELPVPMMIGLGLVSALLLIALLIRALKTRPRH
FT                   PVSGDAGLLGSVTAVTVVQLEDSRNGWVQLQGERWQVLSATPLHTGQPVRVVGRKGLLL
FT                   QVAATDAAPLGE"
     gtgaacattc gttgctgtgc gcttgccctg ttgctgctga gtggatcggt gattgcggcg        60
     gacaacccgt ttaccgccgc cagcccggtc ggtctgtggc tgatcacctt gggcatcacg       120
     tttctgatcg ccgaagccgc gctgcccaac tacggggtga tcggcctcgg cggcatcgtc       180
     atgttcgtga tcggcgcgct gatcctgagc aacgccgaac tgccggtacc gatgatgatc       240
     ggcctcggcc tggtcagcgc cctgttgctg atcgcactgt tgatccgcgc cctgaaaacc       300
     cgaccgcgcc acccggtcag cggcgatgcc ggcctgctcg gcagtgtcac ggcggtgacc       360
     gtggtgcaac tggaagacag ccgcaacggc tgggtgcagt tgcagggaga acgctggcag       420
     gtgctgagcg ccacgccgct gcacaccggg caaccggtgc gggtggtcgg gcgcaagggt       480
     ctgttgctgc aagtggccgc gactgacgcg gcaccgctcg gagagtga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page