(data stored in ACNUC7421 zone)

EMBL: CP000094.PE167

CP000094.PE167       Location/Qualifiers
FT   CDS_pept        204684..204929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71913"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJZ3"
FT                   /protein_id="ABA71913.1"
FT                   /translation="MENPTHSLPSLFKQLGLDNDPVSIDQFIATHSPLKPELHLCDAFF
FT                   WSKSQADFLRDEILDDADWAEVVDQLDVMLRKGRGM"
     atggaaaacc cgacgcacag cctcccatcc ctgttcaagc aactcggcct ggacaacgac        60
     ccggtcagca tcgaccagtt catcgccacc cattccccgc tcaaaccgga actgcacctg       120
     tgcgacgcgt ttttctggag caagagccag gcggatttcc tgcgggacga aattctcgat       180
     gatgcggatt gggcggaggt ggtggatcag ttggatgtaa tgttgaggaa ggggcgggga       240
     atgtaa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page