(data stored in ACNUC7421 zone)

EMBL: CP000094.PE18

CP000094.PE18        Location/Qualifiers
FT   CDS_pept        20177..21202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0018"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71762"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKE4"
FT                   /protein_id="ABA71762.1"
FT                   /translation="MRKSLLALLFLASAGAAHGQVQLKEGFPQQYTVVSGDTLWDISGK
FT                   YLREPWQWPQLWRANPQIENPNLIYPGDTLTLSYVNGQPRLTVNRGESRGTIKLSPRIR
FT                   TSPVAEAIPSIPLKSINSFLLSNRIVDKVEDFDKAPYIVAGDAERVLSGTGDRIFARGH
FT                   FDPNQPVYGIFRQGKVYTDPQTKEFLGINADDIGGGEIVATEGDVATLALQRTTQEVRL
FT                   GDRLFSGEERSINSTFMPSAPTTDINGLIIDVPRGVTQIGAMDVVTLNKGKRDGLAEGN
FT                   VLVVMKTGETVRDRITGQPLKIPDERAGLLMVFRTYDKLSYGLVLNASRSLAVLDKVRN
FT                   P"
     atgaggaaat cactactcgc cctgctgttt ctggcctcgg ccggcgccgc gcacgggcaa        60
     gtgcaactca aggaaggttt tccacagcaa tacacggtgg tttcggggga tacgctctgg       120
     gacatctccg gaaaatattt gcgcgaaccc tggcagtggc cacagctgtg gcgggccaat       180
     ccgcagatcg aaaaccccaa cctgatctac cccggcgaca cactgacgct cagttacgtc       240
     aacggtcagc cgcgcctgac cgtcaatcgc ggcgagtcgc gcggcaccat caagttgtcg       300
     ccgcgcatcc gtaccagccc ggtggccgag gcgattccga gcattccgct caaatcgatc       360
     aacagctttc tgctgagcaa ccgcatcgtc gacaaggtcg aggacttcga caaggcgccg       420
     tacatcgtcg ccggcgatgc cgagcgggtg ctcagcggca ccggcgaccg gatcttcgcc       480
     cgtggccatt tcgacccgaa ccagccggtc tacggcatct tccgccaggg caaggtctac       540
     accgatccgc agaccaagga gtttctgggg atcaacgccg acgacatcgg cggcggcgaa       600
     atcgtcgcca ctgaagggga cgtcgccacc ctcgccctgc aacgcacgac ccaggaagtg       660
     cgcctcggcg accgcttgtt cagtggcgaa gagcgttcga tcaactcgac cttcatgccc       720
     agcgctccca ccactgacat caacggcctg atcatcgatg tgccgcgcgg cgtcacacaa       780
     atcggcgcga tggacgtggt gaccctgaac aagggcaaac gcgacggcct ggccgagggc       840
     aacgtgctgg tggtgatgaa aaccggggaa accgtgcgtg accggatcac cggccaaccc       900
     ctgaaaatcc ccgatgagcg cgccggcttg ctgatggtgt tccgcaccta cgacaaactc       960
     agttacggcc tcgtgctgaa cgcatcgcgc tcgctcgcgg tgctggacaa ggtgcgaaat      1020
     ccttag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page