(data stored in ACNUC7421 zone)

EMBL: CP000094.PE180

CP000094.PE180       Location/Qualifiers
FT   CDS_pept        220889..221449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0182"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71926"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJY0"
FT                   /protein_id="ABA71926.1"
FT                   /translation="MTRLTSLNPWLAAVAVALCVQFPAQAQERFTLSIPGVSDNRLFTS
FT                   AAASDAAGCGGKNQSPALSWNAGPAGTLSYAIVMHDPDGQKGAGVDHWIHYGIKATTRQ
FT                   IPAGVGAKSALEGVGGTNSKGTTSYVGPCPPVGDSAHHYIIQIYALDLAPDALAAGLTR
FT                   AQLMEKIKGHVLRNSSAVRRYHR"
     atgacccgat tgacctctct caacccttgg ctggcggccg ttgccgtcgc cctttgcgtg        60
     cagtttcctg cgcaggccca ggagcgtttc accctcagca ttcccggtgt gtcggataac       120
     cgtctgttca cctcggcggc ggccagcgat gcggccggtt gcggtggcaa gaaccagtcg       180
     ccggccctga gctggaatgc cggcccggcc ggaaccctga gctacgccat cgtcatgcac       240
     gatccggacg gccagaaagg cgcgggcgtc gatcactgga ttcactacgg catcaaggcc       300
     acgacccggc agattcccgc cggcgttggc gccaaatcgg cccttgaagg cgtcggtggc       360
     accaacagca aaggcaccac cagctacgtc ggcccatgcc cgccggttgg cgacagcgcg       420
     caccactaca tcatccagat ctacgccctg gatctggccc cggacgcctt ggccgccggc       480
     ctgacccgcg cccagctgat ggaaaagatc aaaggccacg tgctgcgcaa cagcagtgcg       540
     gtgcggcgtt atcaccgctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page