(data stored in ACNUC7421 zone)

EMBL: CP000094.PE181

CP000094.PE181       Location/Qualifiers
FT   CDS_pept        221537..223228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0183"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71927"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX9"
FT                   /protein_id="ABA71927.1"
FT                   /translation="MSLPSTLLRPLAASVLLVVAGCGVSSSPETTVAPPPAQTELKSSV
FT                   QPEAVMADSAMAKRSALTAPIASFAPMPAGESYPQGYRDEQREQYAKLADNPIHSVTET
FT                   PVSTFSADVDTGAYANVRRLLNQGRLPPEGAVRLEEMVNYFPYDYALPSDGSPFGVTTE
FT                   LAASPWNPHTRLLRIGIKASDRAVAELAPANLVFLVDVSGSMDRREGLPLVKSTLKLLV
FT                   DQLREQDRVSLVVYAGESSVVLEPTSGREKAKIRTAIERLTAGGSTAGASGIELAYQMA
FT                   QQAFIPKGINRILLATDGDFNVGTSDFDSLKQMAVDKRKTGISLTTLGFGVDNYNEHLM
FT                   EQLADAGDGNYAYIDNLREARKVLVDQLGSTLAVVAKNVKLQVEFNPAQVSEYRLLGYE
FT                   NRALKREDFSNDKVDAGEIGAGHTVTALYEIVPTGEKGWLEPLRYGKTDAVVSEKRGEL
FT                   AMLRVRYQKPEGGKSLLIERPIASQVAPASEDLRFAAAVAAFSQQLKDGRYTGDFSLKD
FT                   TEALARGARGDDRFGLRNEFVQLVELAQSLRTSTASNGMSTERRIE"
     atgtcccttc cttccacgct tctgcgcccc cttgctgcca gtgtgttgct ggtggttgcc        60
     ggttgcggcg tttcctccag cccggaaacc accgtcgcgc cgcctccggc gcagactgaa       120
     ctgaagtcct ccgtgcagcc cgaagcggtc atggccgata gcgcgatggc caagcgcagt       180
     gcactgacgg ctccgatcgc cagttttgca ccgatgccgg ccggtgaaag ttatccacag       240
     ggctatcgcg acgaacagcg cgagcagtac gccaagctgg ccgacaatcc gatccacagc       300
     gtcaccgaaa ccccggtctc gacctttagc gccgatgtcg acaccggcgc ctacgccaat       360
     gtgcggcgcc tgctcaatca gggtcgactg ccgccggaag gcgcggtgcg gctggaggag       420
     atggtcaatt actttcctta cgactacgcg ttgccgagcg atggctcgcc cttcggcgtg       480
     accaccgaac tggctgcttc accgtggaac ccgcacaccc gcttgctgcg tatcggcatc       540
     aaagcgtccg accgtgcggt ggcggaactg gccccggcga atctggtatt tctggtggat       600
     gtgtccggct cgatggaccg ccgcgaaggc ttgccacttg tcaaaagcac cctgaaattg       660
     ctggtcgatc aattacgcga acaggatcgg gtatcgctgg tggtgtatgc cggtgaatcc       720
     agcgtggtgc tggagccgac ttccggacgg gaaaaggcga aaattcgcac agccatcgag       780
     cgattgaccg ccggtggctc gactgctggt gcgtcaggca tcgaactggc ttatcagatg       840
     gcgcagcagg cgttcatccc caaaggcatc aaccgcatcc tgttggccac cgacggtgac       900
     ttcaacgtcg gcaccagcga cttcgatagc ctgaaacaaa tggctgtgga taaacgcaag       960
     accgggattt ctctgaccac cctgggtttc ggtgtggata actacaatga acatctgatg      1020
     gaacaactgg ccgatgccgg tgacggcaac tacgcctaca tcgacaacct gcgcgaagcg      1080
     cgcaaggtgc tggtggatca actcggttcg accctcgccg tggtggcgaa aaacgtcaag      1140
     ttgcaggtcg agttcaaccc ggcgcaggtc agcgaatacc ggctgctcgg ctacgaaaat      1200
     cgcgcgttga agcgtgagga tttcagcaat gacaaggttg atgccggtga aatcggtgca      1260
     ggccatacgg tgacggcgtt gtatgaaatt gtcccgacag gcgagaaggg ctggctggaa      1320
     ccgctgcgtt acggaaaaac cgatgcagtg gtttccgaga agagaggaga attggcaatg      1380
     ctgcgcgtgc gatatcaaaa gcctgagggt gggaaaagtc tgctgatcga gcggccgatt      1440
     gccagtcagg ttgcaccagc cagtgaagac ctgcgctttg ctgccgccgt cgctgcgttt      1500
     tcccagcaac tcaaggacgg ccgctacacc ggcgatttca gcctcaagga caccgaagcc      1560
     ctggcccgcg gtgcccgcgg cgatgaccgc ttcggcttgc gcaacgagtt cgtgcaactg      1620
     gtggaactgg cgcagagcct gcgtacctcc accgcctcca acggaatgtc cactgagcga      1680
     cggattgaat ag                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page