(data stored in ACNUC7421 zone)

EMBL: CP000094.PE182

CP000094.PE182       Location/Qualifiers
FT   CDS_pept        223228..223839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0184"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71928"
FT                   /db_xref="GOA:Q3KJX8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX8"
FT                   /protein_id="ABA71928.1"
FT                   /translation="MSRLKGFITQLFAFADSLEASSDESLLARYREGDGKAFEILYARH
FT                   RQSLYRFLLGLSGKPELADEVFQETWLSLIRSSSQPQGRATFRTWLFQIARNRLIDHWR
FT                   KHGARQPLHDSYDEQFHAVSDDASDPEQLLNLSRDSERLESALQSLPADQREVFLLRAH
FT                   GDLDLAQIASLTETPLETVKSRLRYAQQKLRRLLAEEVLT"
     gtgagccgcc tcaaaggctt catcacacag ctgtttgctt tcgccgacag ccttgaggcc        60
     agcagcgacg aatcgctgct ggcccgttat cgcgagggtg acggcaaggc gttcgagatc       120
     ctgtacgccc gccatcggca gagtctttac cggtttctgc tcggtttgag cggcaaaccg       180
     gaactggccg acgaggtgtt ccaggagacc tggctgagcc tgatccgcag tagcagtcag       240
     ccacaaggcc gggcgacctt tcgtacgtgg ttgttccaga ttgcccgcaa tcgcctgatt       300
     gaccactggc gcaagcacgg cgcccgacaa ccgctgcatg acagctacga cgagcaattc       360
     cacgccgtca gcgacgatgc ctcggatccc gaacaactgc tcaacctcag ccgcgacagc       420
     gagcgcctgg agagcgctct gcaatccttg cccgccgacc agcgcgaagt gtttctgctt       480
     cgtgcccacg gcgacctcga cctggcgcaa atcgccagcc tcaccgaaac accgctggaa       540
     accgtcaaga gccgcttgcg ctacgcccag caaaaactgc gtcggctgct ggccgaggag       600
     gtactgacat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page