(data stored in ACNUC7421 zone)

EMBL: CP000094.PE184

CP000094.PE184       Location/Qualifiers
FT   CDS_pept        224459..224728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71930"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX6"
FT                   /protein_id="ABA71930.1"
FT                   /translation="MALTRKNAHYRVIADALEDAVAQKIDRIAQMLNCPVKGEELRRAV
FT                   TESRKEFLLAKQAEEDLEEDVLDDDLIEDEEDDDEYDEFDWTTE"
     ttggcattga cccgcaaaaa cgcgcactat cgggtcattg ccgatgcgct ggaggatgcc        60
     gtggcccaaa aaatcgaccg catcgcccaa atgctcaact gcccggtcaa gggtgaggaa       120
     ctgcggcggg cagtgacgga gagtcgcaag gagtttcttc tggccaagca ggccgaagag       180
     gatctggagg aagacgttct cgatgatgac ttgatcgagg acgaagaaga cgatgatgaa       240
     tacgacgagt ttgactggac gacggagtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page