(data stored in ACNUC7421 zone)

EMBL: CP000094.PE190

CP000094.PE190       Location/Qualifiers
FT   CDS_pept        232056..233987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0192"
FT                   /product="putative sensory box GGDEF/EAL domains protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71936"
FT                   /db_xref="GOA:Q3KJX0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJX0"
FT                   /protein_id="ABA71936.1"
FT                   /translation="MDGRMSATYRDALRAALLYLVLAVVWLQGTGYLLNSFFDSSDELL
FT                   RWQLINGYLFVALSAGLIFLARARLFECLGIGARLRERQADRERLRQAAAVFDCTREGV
FT                   LVTDRQGLIVHVNRAFMEITGYQRDEVIGQQPSLFKSGHHPPGFYQAMFASLQARDEWS
FT                   GEIWNRRKSGEIYPQWQTIRVIRDDDNRLSHYVAVFSDISAIKDSEHELKHLAHHDPLT
FT                   DLPNRLLFSDRAEQALASAQTHKRGCALLMIDLDHFKLINDSLGHTIGDRLLKAVAARL
FT                   QALFGPGITLARLGGDEFAVLLESCPQPAQAAALAQRILDALKEPFCLDGHELFINASL
FT                   GISLFPSDALSAEQLLRNADAALFKAKSSGRNGYALYTEELTAHAQQRVEIAFELRRAL
FT                   EQQELRVYYQPVHDLQTSRLIGVEALVRWEHPQRGLVSPAEFIPIAERTGLISEIDAWV
FT                   MQQACRQMCQWQQAGVVLSFVAVNVSSRLFARRELYQQVAQVLHETGLDPAYLELEVTE
FT                   SAVMDDPEVALEQMHRLRELGIRLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPW
FT                   DEDDAAIVRVIIALARSMGMQVHAEGIEQVEQAAFLLGQACDLGQGYWFGRPVPEAQID
FT                   WNRAPLIG"
     atggacggcc gaatgtctgc cacttaccgc gatgccttgc gtgcagcgct gctttacctg        60
     gtccttgccg tggtctggct gcaaggtact ggttatttat tgaacagttt cttcgatagc       120
     tctgacgagt tgctgcgctg gcaactgatc aacggctacc tgttcgtggc gctcagcgcc       180
     gggttgatct tcctggcccg ggcgcggctg ttcgaatgcc tgggcatcgg cgcccgattg       240
     cgtgaacgcc aggcagatcg cgaacgcctg cgtcaggccg ctgcggtatt cgattgcacc       300
     cgcgaaggcg tgctggtcac ggaccggcag gggctgatcg tgcacgtcaa tcgcgcgttc       360
     atggaaatca ccggttatca gcgcgatgaa gtcatcggcc agcagcccag cctgttcaag       420
     tccgggcatc atccgccggg gttctatcaa gcgatgttcg cttctttaca ggcgcgggac       480
     gaatggagcg gcgagatctg gaaccggcgc aagagcggtg aaatctaccc gcaatggcag       540
     acgatccggg tcattcgtga cgatgacaac cggctcagcc attacgtcgc ggtgttttcc       600
     gacatcagcg caatcaagga ttccgaacac gaactcaagc acctggccca ccacgatccg       660
     ctgactgacc tgcccaaccg tctgctgttc agcgaccgcg ccgaacaggc gctggcatcg       720
     gcgcagaccc acaagcgcgg ctgcgcgctg ctgatgatcg atctggacca tttcaaactg       780
     atcaacgaca gtcttggcca cactatcggt gaccgtttgc tcaaggcggt cgccgcgcgt       840
     ttgcaggcgt tgttcgggcc gggcatcacc ctggcgcggc tgggcggcga tgaattcgcg       900
     gttctgctgg aaagttgtcc acagccggca caggcggcag cgctggctca gcgtattctc       960
     gatgcgctca aggagccgtt ctgcctcgac ggccatgaac tgttcatcaa cgccagcctc      1020
     ggcatcagtc tgtttcccag cgatgcgctg agcgccgaac agctgttgcg caacgccgat      1080
     gcggcgctgt tcaaggccaa gagcagcggc cgcaatggct acgcgctgta caccgaagag      1140
     ctcacggctc acgcccagca gcgggtcgaa atcgccttcg agttgcgccg cgcgctggag      1200
     cagcaggaac tgcgggtcta ctaccaaccg gtgcacgatc tgcaaaccag tcgcctgatc      1260
     ggcgtcgagg cgctggtgcg ctgggagcat ccgcagcggg gcctggtgtc gccggcggag      1320
     ttcatcccga ttgccgagcg caccgggctg atctcggaga tcgacgcctg ggtcatgcag      1380
     caggcctgcc ggcagatgtg ccaatggcag caggccgggg tggtgctgtc gtttgtcgcg      1440
     gtcaacgtgt cctcgcggtt attcgctcgc cgcgagttgt atcagcaggt tgcgcaggtg      1500
     ctgcacgaga ctggcctgga tccggcttat ctggaactgg aggtcaccga aagcgcggtg      1560
     atggacgatc cggaagtcgc gctggagcag atgcatcggc tgcgcgagct gggcattcgt      1620
     ctggccatcg atgacttcgg caccggttat tcgtcgttgc tgcggctcaa gcgcctgccg      1680
     gtgcagaagc tcaagatcga tcagggcttc gtcgccggcc tgccgtggga cgaggacgac      1740
     gctgcgatcg tccgggtgat catcgccctg gcccgcagca tgggcatgca ggtgcatgcc      1800
     gagggcatcg agcaggtgga acaggcggcg ttcctgctgg gccaggcctg tgatctgggg      1860
     cagggctact ggtttgggcg gccggtcccg gaagcgcaaa tcgactggaa ccgggcgccc      1920
     ttgatcggtt ga                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page