(data stored in ACNUC7421 zone)

EMBL: CP000094.PE195

CP000094.PE195       Location/Qualifiers
FT   CDS_pept        237285..238274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0197"
FT                   /product="sulfate/thiosulfate ABc transport system,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71941"
FT                   /db_xref="GOA:Q3KJW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW5"
FT                   /protein_id="ABA71941.1"
FT                   /translation="MSIEVRNVSKNFNAFKALDNISLDIHSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDNGNIVFHGEDVSGHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   NQRPNESQIATKVHELLNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLARLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   DVYENPASDFVYHFLGDSNRLHLGDDNHVLFRPHEVSLSRHELEDHHAAEVRDIRPLGA
FT                   TTRVTLKVEGQTDLIEAEVVKDHDSLTGLAKGETLFFKPKVWQKVANV"
     atgtcgatcg aagtgcgtaa cgtcagcaag aatttcaatg cgttcaaggc gctggacaac        60
     atcagtctgg acatccacag cggtgaactg gtggcattgc tcggcccgtc cggctgcggc       120
     aagaccaccc tgctgcgcat cattgccggt ctggaaaccc cggataacgg caacatcgtg       180
     ttccacggcg aagacgtgtc cggccacgac gtgcgggatc gcaacgtcgg tttcgtgttc       240
     cagcactacg cgctgttccg ccacatgacg gtgttcgaca acgtcgcgtt cggcctgcgc       300
     atgaagccga aaaaccagcg cccgaacgaa agccagatcg cgaccaaggt tcacgagctg       360
     ctgaacatgg tgcaactgga ctggctgtcg gatcgttatc cggagcaact gtccggcggc       420
     cagcgtcagc gtatcgccct ggcccgcgcc ctggcggtag agccgaaagt gctgctgctc       480
     gacgagccgt tcggcgccct cgacgccaag gtgcgtaaag agctgcgccg ctggctggcg       540
     cgcctgcacg aagacatcaa cctgacctcg gtgttcgtga cccacgacca ggaagaggcg       600
     atggaagtgg ccgaccgcat cgtggtgatg aacaagggtg tgatcgagca gatcggctca       660
     ccgggcgacg tctacgaaaa cccggccagc gatttcgtct atcacttcct cggcgattcg       720
     aaccgcctgc atctgggcga tgacaaccac gtgctgttcc gcccgcacga agtgtcgctg       780
     tcgcggcatg agctggagga tcaccacgcc gctgaagtcc gcgatatccg gccgctgggc       840
     gcgaccacgc gggtgacgtt gaaggttgaa ggtcaaaccg atctgatcga ggcggaagtg       900
     gtgaaagacc acgacagcct gaccgggttg gcgaagggag agacgttgtt cttcaagccg       960
     aaggtctggc agaaagtcgc caacgtttga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page