(data stored in ACNUC7421 zone)

EMBL: CP000094.PE196

CP000094.PE196       Location/Qualifiers
FT   CDS_pept        complement(238398..238922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0198"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71942"
FT                   /db_xref="GOA:Q3KJW4"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW4"
FT                   /protein_id="ABA71942.1"
FT                   /translation="MKSLVDHLSQYAAYHRDPRNIASHFIGIPLIVVAVAVLLSRPEWS
FT                   VGGLWISPAVIAALASAWFYLRLELKLGALMTVLMGLSVWAGHVLAQQSTMVWLSSGLA
FT                   MFVIGWAIQFVGHHYEGRKPAFVDDLSGLIVGPLFVVAELAFMLGMRHELKEQIEARAG
FT                   VVRVNPNRAAV"
     atgaaaagcc tcgtcgatca tttgagtcaa tacgccgctt accaccgtga cccgcgcaac        60
     atcgccagcc actttatcgg gattccgctg attgtggtgg cggtggccgt gctgttgtcg       120
     cggccggaat ggtcggtggg tggattgtgg atttccccgg cggtgattgc cgcccttgcg       180
     tcggcgtggt tttacctgcg cctggagctg aagcttgggg ctttgatgac cgtgttgatg       240
     ggcctgtctg tctgggccgg gcatgtactg gcgcagcaga gcaccatggt ctggctcagc       300
     agcggtctgg cgatgttcgt aattggctgg gcgatccagt ttgtcgggca ccactatgaa       360
     gggcgcaaac cggcgtttgt cgatgacttg agcgggttga ttgtcgggcc gctgtttgtg       420
     gtggccgaac tggcgttcat gctcgggatg cgccatgagc tgaaagagca gatcgaggcg       480
     cgggcgggcg tggtgcgggt caatccgaat cgcgcggctg tctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page