(data stored in ACNUC7421 zone)

EMBL: CP000094.PE199

CP000094.PE199       Location/Qualifiers
FT   CDS_pept        complement(240180..240662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0201"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71945"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJW1"
FT                   /protein_id="ABA71945.1"
FT                   /translation="MSVKYLLASLAIGLSGAAHATPELPRHADLDLKTARLLADAALEN
FT                   CTATVSVLDRGGNLLVTLRGDGIGPHNTAASQRKAYTALSTKTPTRLFAERARNNPETA
FT                   NLNTLDELLLLGGGIPLFAGKELVGAMGVAGSGGGEQDESCATKAAEAGGLSINRI"
     atgtccgtca aatacctgct tgccagcctc gcgatcggcc tcagcggcgc ggcgcacgcc        60
     acgcctgagc tgccccgtca cgccgatctc gatctgaaaa ccgcgcggct gctggccgac       120
     gcggcgctgg aaaactgcac cgccacggtg tcggtgctcg accgtggcgg caatctgctg       180
     gtgaccttgc gtggcgacgg tatcggcccg cacaacaccg ccgccagcca acgcaaggcc       240
     tacaccgcgc tgtcgacgaa aaccccgact cgattgttcg ccgagcgcgc ccgcaacaac       300
     ccggaaaccg ccaacctcaa cacgctggac gagttgctgt tgctcggcgg tggcatccct       360
     ttgtttgccg ggaaagaact ggtcggcgcc atgggcgtgg ccggttccgg tggcggtgaa       420
     caggacgaaa gctgtgcgac gaaggcggcc gaagctggcg gtctttccat caaccgaatt       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page