(data stored in ACNUC7421 zone)

EMBL: CP000094.PE202

CP000094.PE202       Location/Qualifiers
FT   CDS_pept        242972..243220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0204"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71948"
FT                   /db_xref="GOA:Q3KJV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV8"
FT                   /protein_id="ABA71948.1"
FT                   /translation="MEQLGELIRTLRKAQKLSQQALAQRYGMSRATISGIENNTISEIG
FT                   LRKVEAILNGFGYELTAVPVRAQRPTLDALQKANFHD"
     atggaacagt tgggcgaact gatcagaact ctgcgcaaag cgcaaaaact ctcgcaacag        60
     gcgttggcgc aacgttacgg catgagccgc gccaccattt ctggtatcga aaacaatacg       120
     atttctgaaa ttggtctgcg caaagtcgag gcgatcctca acggctttgg ctatgagctg       180
     acggcggttc ccgtgagagc gcaacgtccg acactcgacg cgttgcagaa ggccaatttc       240
     catgactga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page