(data stored in ACNUC7421 zone)

EMBL: CP000094.PE203

CP000094.PE203       Location/Qualifiers
FT   CDS_pept        243291..244436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71949"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV7"
FT                   /protein_id="ABA71949.1"
FT                   /translation="MDSVFSYREDAIDENAVSLTMPTRLESYGWERGIHPVFEMNLPEG
FT                   ALRDELVRRFSKAVRGFDDFALLAIVGPHQLGRLAITSESATERQPETSLAELLVHDGA
FT                   QGLFDDLLQKYGQYSGVSGVQPKVLVRDSAAAVDRLTHRGSTHLVKAFRPEEFPELATN
FT                   EYFCMRAAALSGLEVPKFELSEQGKFLVVERFDLIEHGYLGFEDFCVLNGWSSRAKYDG
FT                   SYEGAARQIKAFVSPALLSQALEAFFKIVALSAGLKNGDAHLKNFGVLYDHCGAQASIR
FT                   LAPAYDIITTSVYIRNDSLALLLGGSKAWPKQKALIRFGRTACNLTEGRCNELLQQVVH
FT                   GMQTAMAEMLEHCRTHQSFAEVGTAMIEQWESGIERSLTKG"
     atggacagtg tgttcagtta tcgcgaggac gccatcgacg agaatgcagt gtcgctgaca        60
     atgccgaccc ggctggagag ctacggctgg gagcggggca ttcatcccgt cttcgaaatg       120
     aatctgccgg aaggcgcgct gcgcgatgaa ctggttcgac gcttcagtaa agcagtgcgc       180
     ggttttgatg atttcgcctt gctcgctatc gtcggaccgc atcagttggg acggctggcg       240
     attaccagcg agtcggcaac cgagcgtcag cccgaaacat cattggccga gcttttggtg       300
     catgacggtg cccagggatt gttcgatgat ttgctacaga agtacggcca atactccggg       360
     gtttcgggcg tgcagcccaa agttctggtg cgcgacagtg cggcagcagt tgatcgcctg       420
     actcaccgag gctccacaca tctggtcaaa gccttccgtc ccgaagagtt tcccgagctg       480
     gcgaccaacg agtacttctg tatgcgcgcc gcagcgctta gcggacttga agtgccaaag       540
     tttgaattga gtgagcaggg caagtttttg gtggtcgagc gttttgacct gattgagcac       600
     ggctatctgg gtttcgagga cttttgcgta ctcaacggct ggtcttccag agccaaatac       660
     gatggttctt acgaaggcgc tgcccgacag atcaaggcct ttgtttcgcc tgcgctgttg       720
     agtcaggcgc tggaggcttt tttcaagatc gtggcgctgt cagcgggact gaaaaacggc       780
     gatgcgcacc tgaagaactt cggtgtgctg tatgaccatt gcggtgcgca ggcttcgatc       840
     cggctggccc cggcttacga catcatcacc acatcggttt acatcaggaa cgacagcctg       900
     gccttgctgc tgggcgggtc gaaggcatgg cccaagcaga aggcgctcat ccgcttcggc       960
     cgtacggcgt gcaatctcac tgaaggccgg tgcaatgaac tactgcagca ggttgttcat      1020
     ggcatgcaga cggcgatggc ggaaatgctc gagcattgcc gaacccatca gtcattcgcc      1080
     gaggtgggta cggcaatgat cgagcagtgg gagtccggga ttgaacgcag tctgaccaag      1140
     ggttga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page