(data stored in ACNUC7421 zone)

EMBL: CP000094.PE205

CP000094.PE205       Location/Qualifiers
FT   CDS_pept        245557..246630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0207"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71951"
FT                   /db_xref="GOA:Q3KJV5"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV5"
FT                   /protein_id="ABA71951.1"
FT                   /translation="MDRTSASPQRHNAAQRSAHIREVVLAKGVELRERYPILNHQDALG
FT                   AGILVFALAGMIGSAALYVTGHMAWWACLLLNAFFASLTHELEHDLIHSMYFRKQRVPH
FT                   NLMMGLVWLARPSTINPWIRRHLHLNHHKVSGTETDMEERAITNGEPWGFARLLMVGDN
FT                   VMSAFIRMLRAKTWAHKFSIIKRTLKVYAPLALVHWGAWYVFLGFHAANGIAYLMGSPI
FT                   EWSATTLSVMQVIDIAAVVIIGPNVLRTFCLHFISSNMHYYGDVEPGNVLQQCQVLNPW
FT                   WLWPLQAFCFNFGSSHGIHHFVVKEPFYIRQLTVPVAHKVMREMGVRFNDFGTFGRANR
FT                   FVRKENEGLAGKAIEVN"
     atggaccgta cttctgcaag tccccagcga cacaatgctg cccagcgatc agcgcatatt        60
     cgcgaagtgg tgctggccaa aggcgtcgag ctgcgcgagc gctacccgat tctcaaccat       120
     caggacgccc tcggcgcggg gattctggtg tttgccctgg ccggaatgat cggttcagcg       180
     gcgctctacg tcaccgggca catggcgtgg tgggcgtgtc tgttgctcaa cgcgtttttc       240
     gcttcgctga cccatgagct tgagcacgac cttatccaca gcatgtattt ccgcaaacag       300
     cgggtgccgc acaacctgat gatgggcctg gtgtggctgg cgcggccgag cacgatcaat       360
     ccgtggatcc gccgccatct gcacctcaat catcacaagg tgtctggtac cgaaaccgac       420
     atggaagaac gggcgatcac caatggcgag ccttggggtt tcgcgcggtt gctgatggtc       480
     ggcgacaacg tgatgtcagc gttcatccgc atgctgcggg ccaagacctg ggcgcacaag       540
     ttcagcatca tcaaacgcac gctgaaggtc tacgcgccgc tggcactggt gcattggggc       600
     gcgtggtatg tgtttctcgg gttccatgcc gccaacggga tcgcctacct gatgggctcg       660
     ccgattgaat ggtcggcgac cacgttgtcg gtgatgcaag tgatcgatat cgccgccgtg       720
     gtgatcattg gcccgaacgt gttacgcacg ttttgcctgc acttcatcag ttcgaacatg       780
     cattactacg gggatgtgga gccgggcaat gtgcttcagc aatgtcaggt gctgaatccg       840
     tggtggctgt ggccgttgca ggcgttctgc ttcaacttcg gcagcagtca cgggattcat       900
     cattttgtgg tgaaggagcc gttttacatt cgccagctga cggtgccggt ggcgcacaag       960
     gtgatgcggg agatgggggt tcggttcaac gatttcggga cgttcgggcg ggcgaacagg      1020
     tttgttcgca aggaaaatga agggttggcg ggtaaggcga tcgaggtgaa ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page