(data stored in ACNUC7421 zone)

EMBL: CP000094.PE209

CP000094.PE209       Location/Qualifiers
FT   CDS_pept        251198..252211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0211"
FT                   /product="putative ABC sulfu transport system,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71955"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV1"
FT                   /protein_id="ABA71955.1"
FT                   /translation="MNLPFKRVISLFAAPALAGLLAFSAQADELKEIRIAVPDLSAGTQ
FT                   HSGGGIVDVLRDQQIFEKAFADQGIKIQWSFFKGAGPVINEAFANGQVDLAYLGDLAAI
FT                   IGKSNGLDTRLLSASARGVKQYLGVVPGSGIKTLQDLKGKRVAIFRGTATQLSFDAALA
FT                   SVGLSEKDVKVINLDFNAAVAALAAKQIDASWGSSGLTALQAKGLAELPLNTKDLGGAG
FT                   SVQSVLVGTGKFVDGHPEAVAKLLKAQQQAVEWLTQDSNKDAYVQLVSGLASYPPVILT
FT                   QDLKDQNLSEVFPSTLDPLFLENLQGKVDLAAQQKLIRKPFKVNEWVAPELAAAKL"
     atgaaccttc ccttcaaacg tgtcatcagt ctgtttgccg cgccggcact ggcgggtctg        60
     ctggcgttct ctgcccaggc cgacgagctc aaggaaatca ggattgccgt gcctgatctg       120
     agcgccggta cccagcacag cggcgggggc atcgtggacg tgctgcgcga tcagcagatc       180
     tttgaaaagg ccttcgccga tcaaggcatc aagattcagt ggagcttctt caagggcgcc       240
     ggacctgtga tcaacgaggc attcgccaac ggccaggtgg atctggccta tctcggagat       300
     ctggcggcca tcatcggcaa gtccaacggt ctggacacgc gtctgctcag cgccagcgcc       360
     cggggtgtga agcaatatct cggcgtcgtg ccgggttcgg ggatcaagac gctgcaggat       420
     ctcaaaggca agcgcgtagc gatcttccgg ggcactgcga cccagttgtc gttcgatgcg       480
     gcgctggcca gcgtcggttt gagcgagaag gacgtgaagg tgatcaacct cgatttcaac       540
     gcagcggttg ctgcactggc ggcgaagcag atcgatgcat cgtggggcag ctccgggctg       600
     actgcattgc aggccaaagg actggctgag ctgccattga ataccaagga tctcggtggc       660
     gccggcagtg tgcagtcggt tctggtgggc accggcaagt ttgtcgacgg gcatccggaa       720
     gccgtggcga agctgctcaa ggcgcagcag caggcggtgg agtggttgac gcaggacagc       780
     aacaaggacg cctatgtgca gcttgtgtcg gggctggcga gctatccacc ggtgatcctc       840
     acccaggatc tgaaggatca gaacctgagc gaagtcttcc cttcgacact ggatccgctg       900
     ttcctcgaaa acctgcaggg caaggtggat ctggcggcgc agcagaagct gattcgcaag       960
     ccgttcaagg tcaacgagtg ggtggcgcct gagctggcag ctgcgaagct ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page