(data stored in ACNUC7421 zone)

EMBL: CP000094.PE210

CP000094.PE210       Location/Qualifiers
FT   CDS_pept        complement(252251..253186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0212"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71956"
FT                   /db_xref="GOA:Q3KJV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJV0"
FT                   /protein_id="ABA71956.1"
FT                   /translation="MPEKHMDLRQLRYFIALNEHRSFVRAADAMGITQPAFSRSIQGLE
FT                   QEFGCVLVDRGNKDLRPTPEGQVVLQHALTLVQGAALLSAEVTQMTKLDAGELHFGCGP
FT                   APAVKLVPDAVAQFINAHPKVRTCFQVDNWEKLSRALSREEIEFFIADIRHFESDPNFQ
FT                   TQPLTPKRGVFFCRPGHPLLAKESLSTNDMFDYPLATTLIPPGIRKLLANLSGRIDFSP
FT                   TIETEHFPALVKVVLQSNAIGVGTEEAFVEDIAQGSLALLHWRNLPQNLESMNARCGIV
FT                   SRTGFRLSPAARAMIETLVAVDKQAISVAV"
     atgccggaaa agcatatgga tcttcgccag ttgcgctact tcatcgccct caacgaacac        60
     cgcagttttg tccgcgcggc cgacgccatg ggcatcactc aaccggcgtt cagccgcagt       120
     attcaggggc tggagcagga gttcggctgc gtgctggtgg atcgcggcaa caaggatctg       180
     cgcccgacac ccgaaggcca ggtggtgctt cagcacgccc tgaccctggt gcagggcgcg       240
     gcattactca gcgccgaagt gacgcagatg accaagctcg atgccggcga actgcacttc       300
     ggttgcggtc cggcaccagc ggtgaaactg gtgccggacg cggtggcgca attcatcaat       360
     gcgcacccga aagtacgcac ctgctttcag gtggataact gggaaaaact cagccgcgcc       420
     ctgagccgcg aggagatcga attcttcatc gccgacatcc gccatttcga atccgacccg       480
     aacttccaga cccagccgct gacacccaag cgcggggtgt ttttctgccg gccggggcat       540
     ccgctgctgg ccaaggaaag cctgtcgacc aacgacatgt tcgactaccc gctggcgacc       600
     acgttgatcc cgccgggcat tcgcaaactg ctggcgaatc tcagcggccg gatcgatttt       660
     tcaccgacca tcgagaccga gcattttccg gcgctggtga aagtggtgct gcaatccaac       720
     gcgattggcg tcggcactga agaggcgttt gtcgaggaca tcgcccaagg ctcgctggcg       780
     ctgctgcact ggcgcaatct gccgcagaac ctagagagca tgaatgcgcg gtgcgggatt       840
     gtgagccgca cggggttccg gctgtcaccg gcggcgcggg cgatgatcga gacgttggtg       900
     gcggtggata agcaggcgat cagcgtcgcg gtatga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page