(data stored in ACNUC7421 zone)

EMBL: CP000094.PE213

CP000094.PE213       Location/Qualifiers
FT   CDS_pept        complement(256125..257069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0215"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71959"
FT                   /db_xref="GOA:Q3KJU7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU7"
FT                   /protein_id="ABA71959.1"
FT                   /translation="MHIDLRQLRHFIALAEQRSFVAGAQAVNLSQSAFSRSIQALEHSV
FT                   GCQLVDRGRKELPPTKQGQVLLEHARRLVSGAQQMANEISQFNGLEAGELRFGCGPAPA
FT                   AGLIPRAIGSFIGRYPKARVHYQVDDWQSLSKRLLSEEFEFFVADTRHFEADPDYLTHR
FT                   LRPRKWHFCCRAGHPLGAFERVTAEQLMSYPLAVSIRPPNLRKVIVDLSGRPDFVPNVE
FT                   CENSASLLGVVLRSDAIGIVGAYSDALHQARGELVCLKVEGLADDLEELYTRYGIVSRA
FT                   GYRLSPLAEAMIEQIKAIDAVEEEVCSLANLAV"
     atgcatatcg acttgcgcca gctcagacac ttcatcgccc tcgccgaaca acgcagtttc        60
     gtcgccggcg cgcaggcggt gaacctgtcg cagtcggcgt tcagccgcag cattcaggcg       120
     ctggagcaca gcgtcggttg tcagttggtg gatcgcgggc gcaaggaatt gccgccgacc       180
     aaacagggcc aggtgctgct tgaacatgcg cggcgcctgg tcagcggtgc gcagcagatg       240
     gccaacgaga tcagccagtt caacgggctg gaggctgggg aattgcgctt cggttgtggc       300
     ccggcgccgg cagcgggatt aatcccgcga gcgatcggca gcttcatcgg ccgctacccg       360
     aaagcgcggg tgcattacca ggtcgatgac tggcagagcc tgagcaaacg gctgctgagc       420
     gaagagttcg aattcttcgt tgccgacacc cgacatttcg aggccgaccc ggattatctg       480
     acccaccgct tgcggccacg caaatggcat ttctgctgtc gcgccgggca tccgctgggc       540
     gctttcgagc gagtcacggc agagcaattg atgagttatc cactggccgt cagcattcgt       600
     ccgccaaacc tgcgcaaggt catcgttgac ctcagtggcc ggccggattt cgtcccgaat       660
     gtggaatgtg aaaacagcgc cagcctgctc ggcgtggtgc tgcgctccga tgcgatcggc       720
     atcgtcggtg cctattcaga tgcactgcat caagcccggg gtgaactggt ttgcttgaag       780
     gtcgaagggt tagcggatga tctggaggag ctttacaccc gttacggaat tgtcagccgc       840
     gccgggtatc ggctgtcgcc gttggccgag gcgatgatcg agcagatcaa ggcgatcgat       900
     gcggtggaag aagaggtgtg ctcactggcg aacctcgccg tctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page