(data stored in ACNUC7421 zone)

EMBL: CP000094.PE216

CP000094.PE216       Location/Qualifiers
FT   CDS_pept        260723..261580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0218"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71962"
FT                   /db_xref="GOA:Q3KJU4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU4"
FT                   /protein_id="ABA71962.1"
FT                   /translation="MTLRAFRKETAGSKSMGNVQTAASAQEVLWRQAPSGELVDLGRPH
FT                   RVPLGQLRLQRAPKGILSRRETILLGVLALVVHGAVIYWINQHPTPALPIVPPEIPPMT
FT                   IEFSRPAPPAPPVVVPPPPAPVVEPPPPVEDELATKPPPKPKPIPKPKPVAKPVPKPAP
FT                   KAVEQPPAPPQPAAPVAAPAPPAPPAPAPVTPASANAAYLKNPAPEYPSLAQRRGWEGT
FT                   VLLRVHVLASGKPGEIQIQKSSGRQQLDDAALDAVKRWSFVPAKQGDVAQDGWVSVPID
FT                   FKIH"
     atgacgcttc gggcttttcg caaagagacc gcagggagta aatcaatggg caatgtccag        60
     accgccgcca gcgcacagga ggtgctgtgg cgccaggcgc cgagcggcga gttggtcgat       120
     ctcggccggc cccatcgcgt gccgttgggg cagctgcgtt tgcagcgcgc ccccaagggc       180
     attttgagcc gccgcgaaac gattctgctc ggcgttctgg cgctggtggt gcatggcgcg       240
     gtgatctact ggatcaacca gcatccgacg ccggcgctgc cgatcgtgcc gccggaaatt       300
     ccaccgatga ccatcgagtt ttctcgcccg gcgccaccgg caccacctgt agttgtgccg       360
     ccgccaccgg cacctgtggt tgagcctccg cccccggtgg aggacgaact ggcaaccaag       420
     ccgccaccga aaccaaagcc gattccaaaa ccgaaaccgg tcgccaaacc cgtaccgaaa       480
     ccggcgccaa aagcggtcga gcaaccaccg gctccgccac aaccggccgc cccggtcgcc       540
     gcgcccgcgc cacctgcacc accggcacct gcgccggtga cgccggcctc ggccaacgcg       600
     gcgtacctga agaacccggc gccggagtat ccgtcgctgg cccagcgtcg cggttgggaa       660
     ggcacggtgt tgctccgggt gcacgttctg gccagcggca aaccgggcga aatccagatt       720
     cagaaaagca gtggccggca acagctcgac gacgcggcgc tggacgctgt gaagcgctgg       780
     agcttcgtgc cggccaagca gggtgatgtc gcccaggacg gctgggtcag cgtgcccatc       840
     gatttcaaga ttcattaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page