(data stored in ACNUC7421 zone)

EMBL: CP000094.PE217

CP000094.PE217       Location/Qualifiers
FT   CDS_pept        261626..262351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0219"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71963"
FT                   /db_xref="GOA:Q3KJU3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJU3"
FT                   /protein_id="ABA71963.1"
FT                   /translation="MTLLASPLESIESAVIWLLVVFSVATWGLALLKAVQFGRLKAQDR
FT                   KFHKRFWAASSLDSAAELSETQPGAAARVAQAGYAAIQVGEAPQANDLSQAINHQDRLE
FT                   RALRQQIVRERRSLETGLAVVASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVA
FT                   GPIGAALVATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSSFRVLIH
FT                   PTAHKAAAQGNATKVKEAS"
     atgacgttac tggcatctcc actggaatcc atcgaaagcg cggtgatctg gctgctggtg        60
     gtcttctctg tcgccacctg gggcctggca ttgctcaagg ctgtgcagtt tggccggttg       120
     aaggcgcagg atcgcaaatt tcacaagcgc ttctgggcgg cgtcgagtct ggactccgcc       180
     gccgagttga gcgaaaccca gcccggcgcg gcagcgcggg tggcacaggc cggttatgcg       240
     gcgatacaag tgggcgaggc gccgcaggcc aatgacctga gccaggcgat caaccatcag       300
     gatcgcctcg aacgtgcctt gcgtcagcag atcgttcgcg agcggcgttc gctggaaacc       360
     ggtctggcgg tggtcgcgag tattggcagc acctcgccgt tcattggtct gttcggcacg       420
     gtgtggggaa tcatggaagc gttgaaaggc atcagcgcgg cgggctcggc gagcctggaa       480
     acggtcgcag gaccgatcgg tgcagcgctg gtcgccaccg gtgtggggat cgcggtcgcg       540
     gtgccggcgg tgctggttta caactacttt ttgcgccgtc tgaaactgac ggcggcggac       600
     ctggatgact ttgcccacga cttctacagc ctggcgcaaa agagttcgtt ccgtgtgctg       660
     attcacccga ccgcgcacaa ggctgcggcc cagggcaacg caacaaaagt gaaggaggcg       720
     tcctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page