(data stored in ACNUC7421 zone)

EMBL: CP000094.PE223

CP000094.PE223       Location/Qualifiers
FT   CDS_pept        265919..266584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0225"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71969"
FT                   /db_xref="GOA:Q3KJT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJT7"
FT                   /protein_id="ABA71969.1"
FT                   /translation="MTFDYAFILSTLPAFLKAVGVTLQVGLIAIGTSLLVALLNATILV
FT                   FRTPYLQKLVGLYVELARNTPLLIQLFFVYFALPALGIKVSGFTAAIITMTFLGGAYLT
FT                   EVLRAGVDAVPQAQLESGRSIGLSHGQLLRYVILPQAGILSLPSLFANFIFLLKETTVV
FT                   SAVAVPEILYTTKSYIALYYKTYEMLAVLTLICVLLFLPLSLLLSRLERRLQHGQFGS"
     atgaccttcg attacgcatt tatcctcagc accctgccgg cgtttctcaa ggccgtgggc        60
     gtgacgctgc aggtcggttt gatcgccatt ggcacctcgc tgctggtggc gctgctcaat       120
     gcgacgattc tggtgttccg cacgccttac ctgcaaaaac tggtcgggct gtatgtggaa       180
     ctggcgcgca acacgccgct gctgatccag ttgttcttcg tctacttcgc gctgccggca       240
     ctggggatca aggtttccgg attcaccgcg gcgatcatca ccatgacttt tcttggcggt       300
     gcctacctca ccgaagtgct gcgtgccggc gtcgatgcgg tgcctcaggc gcaactggag       360
     tccgggcgct ccatcggttt gtcccacggc cagttgctgc gctacgtgat cctgccgcag       420
     gccgggattc tcagcctgcc gtcgctgttc gccaatttca ttttcctgct caaggagacc       480
     accgtggtct cggccgtggc ggtgccggag attctctaca ccaccaagag ctacatcgcg       540
     ctctactaca agacctacga aatgctcgcc gtgctgacgc tgatctgcgt gctgctgttc       600
     ctgccgctgt cgctgctgtt gagccgtctg gaaaggaggc tccagcatgg ccagttcggg       660
     tcttga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page