(data stored in ACNUC7421 zone)

EMBL: CP000094.PE234

CP000094.PE234       Location/Qualifiers
FT   CDS_pept        complement(278306..279430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0236"
FT                   /product="putative amino acid ABC transport system,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71980"
FT                   /db_xref="GOA:Q3KJS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJS6"
FT                   /protein_id="ABA71980.1"
FT                   /translation="MTAAIQRRLDLSEPPALAQRTELHPELNRAHVRFVGLGKTYDGKQ
FT                   GTVAALQGIDLAIQRGEVFGIIGRSGAGKSSLIRTINRLEQPTSGRVLIDQVDIGEYDE
FT                   DRLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPKEQREKKVRELLELVGLQAK
FT                   HTAYPAQLSGGQKQRVGIARALVHDPDILLCDEATSALDPETTQSILGLLREINKRLGL
FT                   TIMLITHEMAVIREICDRVVVLEHGRIVEQGPVWEVFGNPQHEVSQTLLAPLQHALPEE
FT                   LQSRLQVQPSSSDASVVLRLQFTGSQQDEPDLAALFAALGGRVKLLQGGVERIQGHALG
FT                   QLLLAVAGSQLNAEQLRERAGQWAQRTEVLGYVV"
     atgaccgcag ccatccaacg gcgactggac ctttcagagc cacctgcgct tgcgcaacgc        60
     accgaactgc atccggaact gaaccgcgct catgtgcgtt tcgtcgggct cggcaaaacc       120
     tacgacggca aacaaggcac ggtcgctgcc ctgcaaggca tcgacctggc gatccagcgc       180
     ggtgaagtgt tcggcatcat cggccgcagc ggcgccggca agtcgtcgct gatccgcacc       240
     atcaaccgcc tcgaacaacc gacctcgggc cgggtgctga tcgaccaggt ggacatcggc       300
     gaatacgacg aggatcgcct cgtcgccctg cggcggcgga tcggcatgat cttccagcac       360
     ttcaacctga tgtcggcgaa aacggtgtgg caaaacgtcg aactgccgct gaaagtcgct       420
     ggcgttccga aggaacagcg ggagaaaaag gttcgcgaac tgctggaact ggtgggcctg       480
     caagccaagc acacggcgta tccggcgcag ctgtccggcg ggcagaaaca gcgtgtcggc       540
     atcgcccgcg cgctggtgca tgacccggac attctgctct gcgacgaagc cacttcggca       600
     ctggatccgg aaaccaccca gtcgatcctc ggcctgctgc gcgagatcaa caaacgcctg       660
     ggcctgacca tcatgctgat cacccacgag atggcggtga tccgggaaat ctgcgaccgc       720
     gtcgtcgtac tggaacatgg ccgcatcgtc gagcaaggcc cggtgtggga agtgtttggc       780
     aatccacagc acgaagtcag ccagaccttg ctcgcaccgt tgcagcacgc tttgcccgaa       840
     gaattgcaga gccgtttgca ggtgcagccg tcgtcgtccg atgcgtcagt tgtgctgcgt       900
     ttgcagttca ccggcagcca gcaggatgag ccggatctgg ccgcgctgtt cgccgcgctt       960
     ggtggccggg tgaaattgct ccagggcggc gtggaacgga tccagggcca cgcgctcggg      1020
     caactgttgc tggcggtcgc tggttcacag ctgaatgccg agcaattgcg tgagcgtgcc      1080
     ggccaatggg cacaacgcac ggaggtgttg ggttatgtgg tttga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page