(data stored in ACNUC7421 zone)

EMBL: CP000094.PE235

CP000094.PE235       Location/Qualifiers
FT   CDS_pept        complement(279433..280242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0237"
FT                   /product="putative amino acid ABC transport system,
FT                   exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71981"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS5"
FT                   /protein_id="ABA71981.1"
FT                   /translation="MTKKLLSHPVKALALAFGLFSSAVFAADAPLKIGTTAAFAIPLEA
FT                   AVEEASKQGLKVELVEFTDWIAPNVSLAAGDIDVNYFQHIPFLENAKAASGFDLVPFAP
FT                   GIINNVGLYSKKYKSFDELPEGASVAIANDPINSGRGLQLLAKAGLITLKPGVGYKATE
FT                   DDIVANPKKIKILQVEAVQLVRAYDDADLVQGYPAYIRLAKTFDAGSALLFDGLDHKEY
FT                   VIQFVIQPKSKTDPRLIKFVDIYQHSPAVRAALDKAHGKLYQAGWES"
     atgaccaaga aactgctgtc ccacccagtc aaagcactgg ccctggcctt cggcctgttc        60
     agctcggctg ttttcgccgc cgatgccccg ttgaaaatcg gcactaccgc cgccttcgcg       120
     attccgctgg aagccgcagt cgaagaggcc tccaaacaag gcctgaaagt cgagctggtg       180
     gaattcaccg actggatcgc gccgaacgtc agcctcgccg ccggtgacat cgacgtgaac       240
     tacttccagc acattccgtt cctggaaaac gccaaggccg cctccggttt cgacctggtg       300
     ccgttcgccc cggggatcat caacaacgtc ggcctgtatt cgaagaaata caaaagcttc       360
     gacgagctgc cggaaggcgc cagcgtcgcc attgccaacg acccgatcaa cagcggtcgc       420
     ggtctgcaac tgctggccaa agccggtctg atcaccctca aaccaggcgt cggctacaag       480
     gctaccgaag acgacatcgt cgccaacccg aagaaaatca agatcctgca ggtcgaagcg       540
     gtgcaactgg tgcgcgccta cgatgacgcc gatctggtcc agggctatcc ggcctacatt       600
     cgtctggcga agactttcga tgccggctcc gcactgctgt tcgacggcct cgaccacaag       660
     gaatacgtga tccagttcgt gatccagccg aagagcaaga ccgacccgcg cctgatcaag       720
     ttcgtcgaca tttaccaaca ttcgccagcc gttcgcgccg cactggataa ggcccacggc       780
     aagctgtacc aggccggttg ggaaagctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page