(data stored in ACNUC7421 zone)

EMBL: CP000094.PE239

CP000094.PE239       Location/Qualifiers
FT   CDS_pept        complement(284360..285124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71985"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS1"
FT                   /protein_id="ABA71985.1"
FT                   /translation="MTRTSHIPELAAPSLAPSRNNGINLAAAAHLLVDVPPYPEMDTGD
FT                   LIELFWNNCYVASHLLTAQDVAAPISLRVPESFIASGSSRIHYRVMRVGHGPSLSAAAR
FT                   VTVKLDCPGGQPPAVCGDENQQLAPVTLPETIRRQGVNANQIKRGVPLTIEPYLNMADG
FT                   DAITLRWGDVRMDLARITPADVGQPIQVWVPPAIITEAGEDLRLDVTYCILDRVGNNSR
FT                   WAPPRTLKIGCVNPYLKVPLKETPKAAEPQKK"
     atgacccgca cttcgcacat ccccgaactg gccgcgccga gcctggcgcc atcccgaaac        60
     aatggcatca acctcgcggc agcggctcat ctgctggtcg atgtgccgcc ttacccggag       120
     atggacaccg gcgacctgat cgaactgttc tggaacaact gctatgtcgc ttctcacctg       180
     ctgacagcac aggacgtcgc ggccccaatc agcctgcgag tgccggaaag cttcatcgcc       240
     agcggttcgt ctcgcatcca ctatcgggtc atgcgggtcg ggcacgggcc atcgctgtcg       300
     gcggcggcgc gcgtcacggt gaaactcgac tgccccggcg ggcagccccc cgcggtgtgt       360
     ggtgacgaaa accagcaact ggcccctgtg accctgcccg agaccattcg ccgtcagggg       420
     gtcaacgcga accagatcaa gcgtggcgta ccactgacca tcgagccgta cctgaacatg       480
     gctgacggcg atgccatcac cctgcgctgg ggcgatgtgc ggatggacct ggcgcgcatc       540
     acccctgccg atgtcggcca gccgattcag gtctgggtgc cgccggcgat catcaccgag       600
     gccggcgaag acctgcggct ggatgtgacc tactgcatcc tcgaccgggt cggcaacaac       660
     tcgcgctggg cgccgccgcg aacgctgaag atcggttgtg tgaatcccta cctcaaggtg       720
     ccgctcaagg aaacgccgaa ggcagcagag ccgcaaaaaa aatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page