(data stored in ACNUC7421 zone)

EMBL: CP000094.PE240

CP000094.PE240       Location/Qualifiers
FT   CDS_pept        complement(285581..286330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0242"
FT                   /product="L-cystine ABC transporter ATP-binding protein /
FT                   Diaminopimelate ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71986"
FT                   /db_xref="GOA:Q3KJS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJS0"
FT                   /protein_id="ABA71986.1"
FT                   /translation="MIVVEKLTKQFKGQVVLNGIDLEVKEGEVVAIIGPSGSGKTTFLR
FT                   CLNFLEEPTSGRIKVGEIEIDTSRPLNQQQNLVRNLRQHVGFVFQNFNLFPHRTALENV
FT                   IEGPIVVKKTPRDAAIALGKKLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEV
FT                   ILFDEPTSALDPELVGEVLATIRGLAEEKRTMVIVTHEMAFARDVANRVVFFDKGVIVE
FT                   QGEAKALFANPKEERTRQFLSKFRNNG"
     atgattgtcg tggaaaaact gacaaagcag ttcaagggtc aagtcgtgct caacggcatt        60
     gacctggagg tgaaggaagg cgaggtcgtg gcaatcatcg ggcccagcgg ctcgggcaag       120
     accacgttcc tgcgttgcct gaacttcctc gaggaaccca ccagcggccg gatcaaggtc       180
     ggcgagatcg agatcgatac cagtcgcccg ctgaaccagc agcagaacct ggtgcgcaac       240
     ctgcgccagc acgtgggctt cgtgttccag aacttcaacc tgttccccca ccgcaccgcc       300
     ctggaaaacg tcatcgaagg cccgatcgtg gtcaagaaga cgcctcgcga tgcagccatt       360
     gccctgggca agaagctgct ggccaaggtt ggcctggcgg gcaaggaaga cgcctaccca       420
     cggcgcctgt ccggtggcca gcaacagcgc gtggcgattg cccgggcgct ggcgatggag       480
     ccggaagtga tcctgttcga cgagccgacc tcggccctcg atccggaact ggtaggtgaa       540
     gtgctggcga ccatccgcgg cctcgccgag gagaaacgca ccatggtgat cgtcacccac       600
     gaaatggcgt tcgcccgtga cgtggccaac cgcgtggtgt ttttcgataa aggcgtgatc       660
     gtcgaacaag gcgaagcgaa agcgttgttt gccaatccga aagaagaacg cactcgacag       720
     ttcctcagca agttcagaaa caacggctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page