(data stored in ACNUC7421 zone)

EMBL: CP000094.PE242

CP000094.PE242       Location/Qualifiers
FT   CDS_pept        complement(287000..287800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0244"
FT                   /product="Diaminopimelate-binding protein /
FT                   L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71988"
FT                   /db_xref="GOA:Q3KJR8"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR8"
FT                   /protein_id="ABA71988.1"
FT                   /translation="MILSALRRNLLVGSLGLALSAGLLGQAVAGEQLQQIKDKGVINVG
FT                   LEGTYPPFSFVDADGKLSGFEVELSEALAKKLGVKAKIQPTKWDGILAALESKRLDVVV
FT                   NQVTISEERKKKYDFSEPYTVSGIQALVLKDKAAALNIKSAADLSGKKVGVGLGTNYEQ
FT                   WVRANVPGADVRTYDDDPTKFADLNNGRTDAILIDRLAALEYAQKAPKTVAAGEAFSRQ
FT                   EAGIALRKGEPELLAAVNKALDELRADGTLEKLSKKYFNADVTQ"
     atgattcttt ccgcactacg tcgaaatctg ctggtaggtt cgctgggcct ggcactgagc        60
     gccggtctgc tggggcaggc ggttgccggt gagcaactgc aacagatcaa ggacaaaggc       120
     gttatcaacg tcggcctgga aggcacttac ccaccgttca gcttcgtcga tgccgacggc       180
     aagctgtcgg gtttcgaagt cgaactgtcc gaagccctgg ccaagaagct gggcgtgaag       240
     gccaagattc agccgaccaa atgggacggc atcctcgcag ccctggaatc caagcgtctg       300
     gacgtcgtgg ttaaccaagt gaccatctcc gaagagcgta agaagaagta cgacttctcc       360
     gagccgtaca ccgtttccgg gattcaggca ctggtactga aagacaaggc agccgcgctg       420
     aacatcaaat ccgccgccga cctgtccggc aagaaagtcg gcgtcggtct gggcaccaac       480
     tatgaacagt gggtccgcgc caacgtgccg ggtgccgacg tgcgcaccta cgacgatgat       540
     ccgaccaagt tcgccgacct gaacaacggc cgtaccgacg cgatcctgat cgaccgtctg       600
     gctgcgctgg aatacgccca gaaagcgcca aaaaccgtcg ctgccggtga agccttctcc       660
     cgtcaggaag cgggtattgc cctgcgcaaa ggcgaacctg aactgctggc cgccgtgaac       720
     aaggccctcg acgaactgcg tgccgacggc acccttgaga agctgtccaa gaaatacttc       780
     aacgctgacg tcacccaata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page