(data stored in ACNUC7421 zone)

EMBL: CP000094.PE245

CP000094.PE245       Location/Qualifiers
FT   CDS_pept        290417..292417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0247"
FT                   /product="putative choline/betaine transport-related
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71991"
FT                   /db_xref="GOA:Q3KJR5"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR5"
FT                   /protein_id="ABA71991.1"
FT                   /translation="MSASSTPASGLVRMNPPVFWFAATVILLFGLTVIAMPEQAGAWLL
FT                   EAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAA
FT                   GISITLFFFCVSEPLTHMLQPPQGEAGTPEAARQAMQILFLHWGLHGWGVFAFVGMALA
FT                   YFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNSGL
FT                   DYLFGIAHTQWIQVGLITLMMGAAIIVAVSGVDKGVRVMSDINMLLACALLLFVLFAGP
FT                   TQHLLNTLIQNLGDYLGALPMKSFDLYAYDKPSDWLGGWTVFYWAWWIAWSPFVGLFIA
FT                   RISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSAIDQVLNHGMSALGMSALDNPSMTLY
FT                   LLLETYPWSKTVIAVTVFISFVFFVTSADSGTVVLSTLSAKGGNPDEDGPKWLRVFWGA
FT                   MTALVTSALLFSGSIDALKSAVVLTSLPFSLILLLMMWGLHKAFYLESQKQIAQLHSLA
FT                   PVSGSRRGKGGWRQRLSQAVHFPSRDEVYRFMDTTVKPAIEEVTAVFAEKGLNVVTQPD
FT                   PAHDSVSLEIGHGEQHPFIYQVQMRGYFTPSFARGGMGSKQLNNRRYYRAEVHLSEGSQ
FT                   DYDLVGYTKEQIINDILDQYERHMQFLHLVR"
     atgagtgcat cgtccacccc cgccagcggt ctggtgcgca tgaatccgcc ggtgttctgg        60
     ttcgccgcga cggtgatcct gctgttcggc ctgacggtca tcgccatgcc ggaacaggcc       120
     ggcgcctggc ttctcgaagc gcaaaactgg gcggccaata cggtcggctg gtactacatg       180
     ctcgcgatga ccctgtatct ggtcttcgtg gtggtcaccg cgttatcggg ctacggcaag       240
     atcaaactcg gtgccgacca cgacgaaccc gaattcagtt acctgtcctg ggccggcatg       300
     ctgttcgccg ccgggatcag catcacgctg tttttcttct gcgtatccga gccgctgacc       360
     cacatgcttc agccgccgca aggcgaggcc ggcaccccgg aggcggcgcg tcaggcgatg       420
     cagattctgt ttctgcactg gggcctgcac ggctggggcg tgttcgcctt tgtcggcatg       480
     gcgctggcgt atttcgctta tcggcacaat ctgccactgg ccctgcgttc ggcgctgtac       540
     ccgctgatcg gcaaacgcat caacggcccc atcggctacg cggtggacgg cttcggcatc       600
     atcgccacgg tgttcggcct cggtgcggac atgggcttcg gcgtgctcca tctcaactcc       660
     ggtctggact acctgttcgg catcgcccac acccagtgga ttcaggtcgg cctgatcacg       720
     ctgatgatgg gcgcagcgat catcgtcgcc gtctccggtg tggataaagg cgtgcgggtc       780
     atgtccgaca tcaacatgct gctggcctgt gcgctgctgc tgttcgtgtt gttcgccggc       840
     cccacccagc atttgctcaa caccctgatc cagaatctgg gcgactacct cggcgcgttg       900
     ccgatgaaga gtttcgacct ctacgcctac gacaaaccga gcgactggct cggcggctgg       960
     acggtgttct actgggcctg gtggattgca tggtcgccgt tcgtaggcct gttcatcgca      1020
     cggatttccc gtggccggac aatccgcgaa ttcgtcttcg gcgtgctgct gattccgctc      1080
     ggtttcaccc tggcgtggat gtcgatcttc ggcaacagcg ccatcgacca agtgctcaac      1140
     cacggtatgt cggcgctggg catgtcggcc ctcgacaacc cgtcgatgac cctctacctg      1200
     ctgctggaaa cctatccgtg gagcaagacc gtcatcgcgg tgacggtgtt catcagcttc      1260
     gtgttcttcg tcacctccgc cgactccggc accgtggtgc tctcgaccct gtcggccaag      1320
     ggcggcaacc cggatgaaga cgggccgaaa tggctgcggg tgttctgggg cgcgatgacc      1380
     gcgctggtga ccagtgcgct gctgttctcc ggcagcatcg atgcgctgaa gtcggcggtg      1440
     gtgctgacct cgttgccgtt ctcgctgatt ctgctgctga tgatgtgggg cctgcacaag      1500
     gcgttctatc tggagtcgca gaagcagatc gcgcaactgc attccctggc gccggtgtcc      1560
     ggctcacggc gtggcaaggg cggctggcgt cagcgtctga gccaggccgt gcacttcccg      1620
     tcgcgcgacg aggtgtaccg cttcatggac accacggtga aaccggccat cgaagaagtg      1680
     acggccgtgt ttgccgagaa aggcctgaac gtggtcaccc aaccggatcc ggcgcacgac      1740
     agcgtcagtc tggaaatcgg acacggcgag cagcacccgt ttatttatca ggtgcagatg      1800
     cgcggctact tcacgccgtc gttcgcccgc ggaggcatgg gctccaagca gctcaacaat      1860
     cgccgctact accgcgccga agtgcatctg agcgagggca gtcaggacta cgatctggtc      1920
     ggttacacca aagagcagat catcaacgac atcctcgacc agtacgaacg gcacatgcag      1980
     ttcctgcatc tggtgcgttg a                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page