(data stored in ACNUC7421 zone)

EMBL: CP000094.PE246

CP000094.PE246       Location/Qualifiers
FT   CDS_pept        complement(292442..292702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71992"
FT                   /db_xref="GOA:Q3KJR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJR4"
FT                   /protein_id="ABA71992.1"
FT                   /translation="MHTAIIIFFGLILLALMFYIGERIGFSRQTQAYGFAALWLALTVI
FT                   NGAVGVVHAGQPLGTEIAIGSAVYGVPLAAMVLFMVLSAET"
     atgcacaccg caatcatcat cttcttcggc ctgatcctgc tggcgctgat gttctacatc        60
     ggcgagcgca tcggtttcag tcggcagacg caggcctatg gtttcgcggc gttgtggctg       120
     gcgttgacgg tgatcaatgg tgcggtcggc gtggtgcacg ccgggcagcc gctggggacg       180
     gagattgcga tcggcagcgc cgtgtatggc gtgccgctgg cggcgatggt gttgttcatg       240
     gtgctgagcg ccgagacctg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page