(data stored in ACNUC7421 zone)

EMBL: CP000094.PE252

CP000094.PE252       Location/Qualifiers
FT   CDS_pept        complement(299890..300729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0254"
FT                   /product="taurine ABC transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71998"
FT                   /db_xref="GOA:Q3KJQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ8"
FT                   /protein_id="ABA71998.1"
FT                   /translation="MSSYDVSATAVKPAATSVVIPVRRSLSTRWISLLTLFALLVIWWA
FT                   VTASGLIEPLFLPPPSAVLQKGWLLATTGYMDSTLWQHLGASLSRIGLGLGFAILTAVP
FT                   VGIAIGANRIARGVLDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGATRAQLIRHVILPSALPDILTGVRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILVIALIAFAMEMGLRALQRKLVPWHGQAH"
     atgagcagtt acgacgtttc cgctaccgcc gtgaaacccg ccgccacgtc ggtggtgatt        60
     cccgtgcgcc gcagcctcag cacccgctgg atcagcctgc tgaccctgtt cgcattgttg       120
     gtgatctggt gggcggtgac ggccagtggc ctgatcgagc cgctgttcct gccgccaccg       180
     tccgccgtgc tgcaaaaagg ctggttgctg gcgaccacgg gttatatgga ttcgacgttg       240
     tggcagcact tgggcgcgag cctgagccgc atcggtctgg gcctgggttt tgcgattttg       300
     accgcagtgc cggtgggcat tgccatcggc gccaaccgca tcgcccgtgg cgtgctggat       360
     ccgctgatcg agttctaccg gccgattccg ccactggctt atctgccgct gatcgtgatc       420
     tggtgcggca tcggtgagtt gtcgaaagtg ctgctgatct atctggcgat tttcgctccg       480
     atcgcgattg ccaccgccac cggtgtgcgc accgtcgacc cggccaaatt gcgcgccgca       540
     cagtcgctgg gcgccactcg cgcacaactg atccgccatg tgattttgcc aagcgccctg       600
     ccggacattc tgaccggtgt gcgcattggc ctgggtgtgg gttggtcgac gctggtcgcc       660
     gccgaactga tcgcggccac cagcggcctg ggcttcatgg tgcagtcggc tgcgcagttc       720
     ctggtcaccg atgtggtggt gctggggatt ctggtcatcg ccctgatcgc cttcgctatg       780
     gagatgggcc tgcgcgccct gcaacgcaaa ctggtgccgt ggcacggcca ggcccactga       840
//

If you have problems or comments...

PBIL Back to PBIL home page