(data stored in ACNUC7421 zone)

EMBL: CP000094.PE254

CP000094.PE254       Location/Qualifiers
FT   CDS_pept        complement(301537..302514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0256"
FT                   /product="taurine ABC transport system, substrate-binding
FT                   periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72000"
FT                   /db_xref="GOA:Q3KJQ6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJQ6"
FT                   /protein_id="ABA72000.1"
FT                   /translation="MKLNFPLRLLAVASLAAASFLAQAADLTVAYQTTVDPAKVAQADG
FT                   AYEKATKADINWRKFDNGADIIAAIASGDVQIGYLGSSPLTAAITRKVPVETFLIATQI
FT                   GAAEALVARDGSGIKTPQDLVGKKIAVPFVSTGHYSLLAALKHWNIDPSKVTVLNLAPP
FT                   AIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAKFGAPTFDAWIVRKDFAEKHP
FT                   EIVTAFAKVTLDAYADYRKDPKAWLANQSNVDKLVKLSGAKASDIPLLLQGNVYPLAAD
FT                   QVSDLGAPTTKAITDTATFLKEQGKVEAVLPDYAPYVSAKYITN"
     atgaaactga atttcccgct tcgcctgctg gccgtggcct ctctggccgc tgcgagtttc        60
     ctggctcagg ccgccgacct caccgtcgcc taccagacca ccgttgaccc ggcgaaagtc       120
     gcccaggccg acggtgccta cgagaaagcc accaaggctg acatcaactg gcgcaaattc       180
     gataacggcg ccgacatcat tgccgccatc gcgtccggtg acgtgcagat cggttacctc       240
     ggttccagcc cgctgaccgc cgcgatcacc cgcaaagttc cggtggaaac cttcctcatc       300
     gccacccaga tcggcgccgc cgaagcactg gtcgcccgcg acggctctgg catcaagacg       360
     ccgcaggatc tggtcggcaa gaaaatcgcc gtgccgttcg tgtccaccgg tcactacagc       420
     ctgctggccg cgctgaagca ctggaacatc gatccatcga aagtcaccgt cctcaacctc       480
     gccccgccag cgatcattgc tgcgtggaaa cgcggtgaca tcgacgctac ctacgtctgg       540
     gatccggcgc tgggtgtggc caaggaaaac ggcaaagtgc tgatcacatc cggtgaactg       600
     gccaagttcg gcgcgccgac cttcgacgcc tggatcgtgc gcaaggactt cgccgagaag       660
     cacccggaaa tcgtcaccgc cttcgccaag gtcaccctcg acgcctacgc cgactaccgc       720
     aaggatccga aagcctggct cgccaaccag agcaacgtcg acaagctggt gaagctctcc       780
     ggcgccaagg ccagcgacat cccattgctg ctgcaaggta acgtctaccc gctggcggcg       840
     gatcaggtca gtgacctcgg cgcgccgacc accaaagcca tcaccgatac cgccacgttc       900
     ctcaaagaac aaggcaaggt cgaagcggtg ctgccggact acgcgccgta cgtcagcgcc       960
     aagtacatca ccaactga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page