(data stored in ACNUC7421 zone)

EMBL: CP000094.PE261

CP000094.PE261       Location/Qualifiers
FT   CDS_pept        complement(310730..311209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP9"
FT                   /protein_id="ABA72007.1"
FT                   /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATDIE
FT                   PFERDGEKWVRFTAHLGTVVQLRHRRCEAPLVARKTIKSSNGQAQVRYVISTTLALGDR
FT                   VWPIEFTLACRKSMRYRLLLGSKALIDGQLVVNPGIKYVQDKPVFPVSTSSTGVA"
     ttgaagacat ttgaccattt gaccgttatc ggtctgcgcg agtgggtggc gcttccggat        60
     ctgggagtcg ctggccttcg ggcaaaaatc gacaccggcg ccagcacctc cagcctgcat       120
     gccaccgaca tcgagccgtt cgaacgcgac ggcgagaagt gggtgcgttt caccgcgcac       180
     ctgggcactg tcgtgcagtt gcgccatcgg cgatgcgaag cgccgctggt tgcccgcaag       240
     accatcaaga gttcgaacgg ccaggcccag gtgcgctacg tgatcagcac caccctggcc       300
     ctgggtgacc gggtctggcc gatcgagttc accctcgctt gccgcaagtc catgcgctat       360
     cgcctgttgc tcggttccaa agccttgatc gacggccagc tggtggtcaa tccgggcatc       420
     aaatatgtac aagacaagcc ggtgttcccg gtatctacct cctccacagg tgttgcatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page