(data stored in ACNUC7421 zone)

EMBL: CP000094.PE264

CP000094.PE264       Location/Qualifiers
FT   CDS_pept        complement(312596..313396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72010"
FT                   /db_xref="GOA:Q3KJP6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP6"
FT                   /protein_id="ABA72010.1"
FT                   /translation="MNNPGLFQSRWNLGRLVLCNVVPLALLAFWLWPTGQMLCVIFDEW
FT                   LFRSLNAPLASNPIWLHIWAIASLRPFDIVVGVILLMLLIKGDWVFRAIDVRRAFFGFF
FT                   SILLLMVVIRALFSKFSDHMGWQHSSPSMVLEGAVHISDYFPHLEKTWELKDRSSQSFP
FT                   GDHASVLLIWALFMGVFSRTAGQFLVIWGLALLFMLPRLVAGAHWGQDDYIGGMLLAVW
FT                   ALGWGYYTPFAYHAANFWLKVTAPVFRLLGKLPMVSRMSVVSAQ"
     atgaacaatc cgggtttgtt ccaatcaagg tggaacctcg gccggctggt tctgtgcaac        60
     gttgtgccat tggcactgct ggctttctgg ttatggccta caggtcagat gctgtgtgtg       120
     attttcgacg agtggctgtt ccgctcactc aatgcaccgc tggccagcaa ccccatatgg       180
     ctccacatct gggcaattgc aagtctgcga ccgttcgaca ttgtcgtcgg tgtgattctg       240
     ctgatgctgc tgatcaaggg cgactgggtg ttcagggcaa ttgatgtacg ccgcgcattt       300
     ttcggttttt tttcgatcct gctgctgatg gtggtgatcc gcgcgctgtt ttccaagttc       360
     tccgatcaca tgggctggca gcacagcagc ccgtcgatgg tgctcgaagg cgcggtgcat       420
     atcagcgatt acttcccgca tctggagaag acctgggagc tgaaggaccg ctcgagccag       480
     agcttccccg gtgaccacgc atcggtgctg ctgatctggg ctcttttcat gggcgtgttc       540
     agccgtacgg ctggtcagtt cctggtgatc tggggtctgg cgctgctgtt catgttgcct       600
     cgcctggtcg ccggtgcaca ttggggccag gacgattaca tcggcggcat gctgctggcg       660
     gtgtgggcac tgggctgggg ttactacacg ccgtttgctt atcacgcggc gaacttctgg       720
     ctgaaggtca cggcgccggt gttccggctg ctgggcaaac tgccgatggt ttcgcggatg       780
     agcgtggtgt ccgcgcagta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page