(data stored in ACNUC7421 zone)

EMBL: CP000094.PE267

CP000094.PE267       Location/Qualifiers
FT   CDS_pept        complement(316192..316491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0269"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72013"
FT                   /db_xref="GOA:Q3KJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP3"
FT                   /protein_id="ABA72013.1"
FT                   /translation="MEMTMSKFFDELMESVQEMDEIVRGERTPSREFHVDALQVKEIRK
FT                   ATGLTQAKFAALIDVQLGTLRNWEQGRREPTGPAKALLKAIHNDPVHVLNALAH"
     atggagatga ccatgagcaa attttttgat gagctgatgg aaagtgtgca agagatggac        60
     gagatcgtac gaggcgagcg cacaccttct cgcgaattcc acgttgatgc attgcaggtc       120
     aaagaaattc gtaaagctac cggtttgacc caggccaaat ttgcggcact gatcgacgtc       180
     cagctcggca ctctacgaaa ttgggaacag ggtcgtcgcg agccaaccgg gccggcaaaa       240
     gctctgctca aggccattca taacgacccg gttcatgttt tgaatgcatt ggcccattga       300
//

If you have problems or comments...

PBIL Back to PBIL home page