(data stored in ACNUC7421 zone)

EMBL: CP000094.PE270

CP000094.PE270       Location/Qualifiers
FT   CDS_pept        complement(317758..318885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72016"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJP0"
FT                   /protein_id="ABA72016.1"
FT                   /translation="MTTLTIFFCGTGSTKFDSAHENYWNGELVSTLASHHTGREFADWI
FT                   VVDGPGTSNLQADELFTQSKDYGLSGTLFGKGWEENVQHAMNIIKGKCDWQRQQLTETE
FT                   YNRLKAAGIPIEDVKVEGSWLWRKYNYGDRSVTQQKLQEQIIKTFRKDGVIPTKVNLVG
FT                   WSRGGISCHMLANAMFNDSMLTNIPVNIFAIDPVPGIGNFQEHRVKLNYNVKEYVGFYA
FT                   RDERSKGFSCVIPQTATGTKTSIFPMPGRHATLVGNASADGNSGPKVLAEPGLIVRHFA
FT                   EVCLKRWGTVLDKNLNLTDADLRNHTAAIVNAAAKYKAMEKCSYTWFTELDQGERYVSL
FT                   GSKGVPFSTVKGGIYTPATGLTTSVLDVEGYRAIR"
     atgactacac taactatttt cttctgcggt acaggttcga caaagtttga tagcgcccac        60
     gaaaactact ggaatggtga attggtatct acactcgcct cccatcacac cgggcgcgag       120
     ttcgccgact ggatcgtggt cgacggtccc ggcaccagca acctgcaagc cgatgaactg       180
     ttcacccagt ccaaggacta cggcctgagc ggaaccctgt tcggcaaggg ctgggaggaa       240
     aacgttcagc acgcgatgaa catcatcaaa ggcaaatgcg actggcaacg tcagcaactg       300
     accgaaacgg aatacaaccg cctcaaagcc gccggcattc cgattgaaga tgtaaaggtc       360
     gaaggttcct ggctatggcg caaatataac tatggcgacc gcagcgtcac ccaacagaaa       420
     ttgcaggaac aaatcattaa aaccttccgc aaggacggcg ttattccaac gaaggtcaat       480
     ctggtgggct ggagccgcgg cggtatcagt tgccatatgc tggccaacgc catgttcaat       540
     gacagcatgc tgacaaacat tccggttaat atcttcgcca ttgatccggt acccggcatc       600
     ggtaactttc aggagcacag ggttaaactc aattacaacg taaaggaata cgtgggcttt       660
     tatgcacggg acgaacgctc caagggtttc agctgcgtca tcccgcaaac cgcgaccggc       720
     accaagacca gcatcttccc gatgcctggc cgtcacgcca ctctggtcgg taacgcctcc       780
     gccgatggca acagtggtcc caaagtgctg gccgaacccg gcctcatcgt ccgccacttt       840
     gccgaggtct gcctgaaacg ctggggcacc gtactcgaca aaaaccttaa cctcaccgac       900
     gccgaccttc gcaaccacac cgccgccatc gtcaacgcgg cagcgaaata caaggccatg       960
     gagaagtgct cctacacctg gttcaccgag ctggatcaag gcgaacgcta cgtatcgctg      1020
     ggcagcaaag gcgtgccgtt ctcgacggtg aaaggcggga tctacacccc ggcgaccggg      1080
     ctgacgacga gtgtgctgga tgttgagggg tatcgggcga ttcgttga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page